KEGG   Esox lucius (northern pike): 105024554Help
Entry
105024554         CDS       T04894                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
els  Esox lucius (northern pike)
Pathway
els03030  DNA replication
els03410  Base excision repair
els03420  Nucleotide excision repair
els03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105024554 (lig1)
   03410 Base excision repair
    105024554 (lig1)
   03420 Nucleotide excision repair
    105024554 (lig1)
   03430 Mismatch repair
    105024554 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:els03032]
    105024554 (lig1)
   03400 DNA repair and recombination proteins [BR:els03400]
    105024554 (lig1)
Enzymes [BR:els01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105024554 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     105024554 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105024554 (lig1)
DNA replication proteins [BR:els03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105024554 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105024554 (lig1)
DNA repair and recombination proteins [BR:els03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105024554 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     105024554 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     105024554 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 105024554
NCBI-ProteinID: XP_010892858
UniProt: A0A3P8ZYX5
LinkDB All DBs
AA seq 1069 aa AA seqDB search
MQRSIASFFQPKTGKEKESKKTNGPVKEKPEPVKCPLKVQNGVQSETDSPVKKSSKRSRQ
ILDSDDDDPSAGKEQSVRQDKEDKPVKPKKEQDEELKAVSTPLTPVAAPATPVTPATPVT
PATPVTSATPVTPATPVTSATPVTPAASGTPETPTSISPSGIPKRRTARKQFPKRKLDSQ
SGSEKDQEEDEAKERQGQENKRARVDKKQDSTENEEEAMEVGEEEKCLDGLEVEPNKPEK
KEKHEKKTHQDEKEKAIDANETATKNSEEDGKKLKDEKGKGKSPKAQMLKEKSPKNEKAK
EKSQRSQKKEKERSPKNEKQPIKEEIVTKEERVSESPQAKKAPISSFFAPRKAAMKMEKA
EKKSEGDKKEKSEGDKKEKSEGDKKEKSEGDQSVEQKEGAKVPSTSEDQKGGKADRSQFD
PSRPNYHPVDHACWVQGQRVPYLAVARTFEKIEEDSGRLRNIETLSNLFRSVIALSPEDL
LCCVYLCLNQLGPAYLGLELGVGETVLMKAVAQATGRQLDKIKAEAAEKGDLGLVAESSR
SNQRIMFQPASLTAVGVFNKLKDIGNMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLA
GKLRIGLAEQSVLAALSQAVCLTPPGQEFPPAVIDAGKGMSAEKQKSWIEEKSLILKQTY
CEMPSYDVIIPVLLKEGIDELPRHCKLTPGIPLRPMLAHPTKGVGEVMKRFDEAAFTCEY
KYDGERAQIHILENGEVRIFSRNQEDNTTKYPDIISRIPTVKRESVVSCVLDAEAVAWDR
EKKQIQPFQVLTTRKRKDVDAADVKVQVCVYAFDLLYLNGESLVKQTLSRRRALLKESFQ
EKEGEFVFARAIDSNDTDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKK
DYLDGVGDTMDLCVIGAYLGKGKRTGMYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQ
HYKFLKEHILPKPRPYYRVDPSAGPDVWLDAVQVWEVKCADLSLSPIYKAGMGLCDPEKG
ISLRFPRFLRIRDDKKPEEATSGGQIADLYQKQQVVQNQGDKADLEDYY
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatagcgtctttctttcagcccaaaacaggcaaagaaaaggaaagcaaa
aagactaatggtccagtgaaagagaaaccagaacctgtcaaatgtccgctgaaagtgcag
aatggggtccagagtgagacggattcccccgtaaagaagtcaagtaaacgcagtcgtcag
atcctggacagtgacgacgatgacccgtcggctggcaaagaacagtcggtcagacaggat
aaagaggacaagcctgtcaagccaaaaaaagagcaggatgaagaattgaaggcggtgtcc
acccccttgactcctgttgctgccccagccacacccgtgaccccagccacacccgtgacc
ccagccacacctgtgacttcagcgacacccgtgaccccagccacacctgtgacttcagcc
acacccgtgaccccagcagcgtctggaacgcccgagacccccacatctatctcaccgtcc
ggaatacccaaacgccggaccgccaggaagcagttcccaaagaggaagctggacagtcag
agtggcagtgagaaggatcaggaggaggacgaggcaaaggagaggcaaggccaggagaat
aaaagggcaagggttgacaaaaaacaggacagcaccgagaacgaagaggaagcgatggag
gtaggagaggaggaaaaatgtttggatggacttgaggtggagccgaacaaaccagagaag
aaagagaagcatgaaaagaagacccaccaagacgagaaggagaaagcaatcgatgcaaat
gaaactgcgaccaagaattcagaggaagatggaaagaagttaaaagatgaaaaggggaaa
ggaaaaagtcctaaagctcaaatgctgaaagaaaaaagtcctaaaaatgaaaaggcaaaa
gaaaaaagtcagagaagtcaaaagaaagagaaggaaagaagtcctaaaaatgaaaagcag
ccaataaaggaagaaatagttacaaaggaggagagagtgtcagaaagccctcaagccaag
aaagcccccatcagtagtttctttgctcccaggaaagccgctatgaagatggagaaagct
gagaagaagagcgagggagacaagaaggagaagagcgagggagacaagaaggagaagagc
gagggagacaagaaggagaagagcgagggagaccagagcgtggagcagaaggaaggggcc
aaggtgcccagtacctctgaggaccagaaaggtggcaaggcagaccggtcccagtttgac
ccgtccagacccaactaccaccctgtggaccatgcctgttgggtgcagggacagagggtc
ccttatttggctgttgcacgcacctttgaaaagatagaggaagactctggcaggttgagg
aacattgaaactttgtcaaatcttttccgctctgtgatcgctctctctccagaggacctg
ctctgctgtgtctacctgtgtctcaatcagctggggcccgcttacttgggcttggagctg
ggagttggagagaccgtgctgatgaaagctgttgcccaagcaactgggcgacagttggac
aaaatcaaggcggaggctgcggagaagggagacttggggttggtggctgagagttcccgt
agcaaccaaagaattatgttccagccagccagtctgacagcggtgggcgtgttcaacaaa
ctgaaagacattgggaacatgagtgggaactctgccatgaataagaagatcgacatcatc
aaaggcctctttgtagcctgccgcttctctgaggccagatacattgtcaggtctctggca
gggaagctgaggattggcttggctgagcagagtgtactagctgccctgagtcaagcagtg
tgtctgactcctccgggacaagaattccctccggcggtaatcgatgcaggaaaaggaatg
agtgcagaaaaacagaaatcctggatagaggagaaaagcctaatactaaaacagacctac
tgtgagatgcccagctatgatgtcatcatccctgtcctgctgaaggaaggcattgatgaa
ctgcccaggcactgcaaactcaccccaggtatccctttgaggcctatgttggctcacccc
actaaaggtgtaggagaggtgatgaagaggtttgatgaagccgctttcacctgcgagtat
aagtatgatggggagagagcacagatccatatcttagagaacggagaagttcgcattttc
agtcgcaaccaggaggacaataccaccaaatatcccgatatcatctctcgcattcccacg
gttaagagggagtctgtggtgtcctgtgtgttggatgctgaggcggttgcttgggaccga
gagaagaaacagatccagccattccaggtgctcaccacgcggaagaggaaggatgtggac
gcagctgatgtcaaggtccaggtgtgtgtgtacgcctttgacctgctctatctcaacgga
gagtctttggtaaagcagaccttgtctcggcgtagggctctgctgaaggagagctttcaa
gagaaggagggagagttcgtgttcgcccgcgccatcgactcaaatgacacggacgccatc
gcggagttcctggagcaatctgtccgagactcctgtgaggggcttatggtgaagactctg
gagaaagatgctacctacgaaatcgccaagcgctcccacaactggctgaagctgaagaag
gactatctcgatggggtcggggacacgatggacctgtgtgtgatcggagcgtatctgggg
aagggcaagagaacggggatgtatggaggcttcctgctcgcctgctatgatgaggacaat
gaggagttccagtctgtctgcaagattgggacgggtttcaaggatgaggatttggagcaa
cattacaaattcttaaaggagcacattctgcccaagccccgtccgtattatcgcgtggac
ccctccgccggtccggatgtctggctggatgccgttcaggtatgggaggtgaagtgtgct
gacctgtcactttcgcccatctacaaggctggcatgggattgtgtgacccagaaaagggc
atctctcttcgcttcccacgcttcctgaggatcagagatgacaagaagccggaagaagcc
acttcaggaggacagattgctgatttgtaccagaagcagcaggttgttcagaaccaagga
gacaaggctgaccttgaggactactactga

DBGET integrated database retrieval system