KEGG   Esox lucius (northern pike): 105025333Help
Entry
105025333         CDS       T04894                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105025333 (mapk6)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105025333 (mapk6)
Protein kinases [BR:els01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105025333 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 105025333
NCBI-ProteinID: XP_010894244
LinkDB All DBs
AA seq 803 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFQTLGPSGRHLTEDIVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEDHSRLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHKVIPVFIRSDMTQPHNPLARLLPDVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPVSLHPFHIEDEVDDILLMDQSHSHTWDRYRDSQL
SEGDWHLHTHSTLDPDEVQVDPRALSDNTDDEDVQVDPRKYTDGDREKFLDDPSYDYTSL
FPPERSWPDEDDLHHENKYCDLECSHTCNYKATSPSYLDNLILRDSVVNHYYEPKLIIDL
SNWKEQQNKEKLAVDKERKAQKSKCEKNGLVKARMALQEAEKSHSPEEKDSQQEKNQNHT
AQQSQGFDFDSFIAGTIKLSLQPEPSEVGLLSEVGLLSEVGLLSEVGLLNEVGLLNEVGV
SLLSEVGLLNELNSSVSQLEASRSGSMSKSISQEKEEKCLVNFAQVSSTVGTTGSGQRPA
HPWESFGGGERVEEGRGGCLIDEAGRWDVGKEEQLQKESSYTSYLDRLFSKKDEGCGESA
ASASDSSEPEPSEAGGERDEGGFLARSGEIMFNMQLDSLALPRFDATADLPLKSIQASLA
PSAVRCSPQIAHKTYSSIFKHLN
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagtttgagtctttgatgaacatccatgggtttgacctgggcccacgctac
atggacctgaagcctctgggctacggtgggaacggcctggtattctcagcggttgacacg
gactgtgacaaacgtgtggcggttaaaaagatcatcctgacagacccccagagcgtcaaa
cacgccctccgagagatcaagatcatcaggaggctggatcacgacaacattgtcaaggta
ttccaaacattagggcctagcggccgccaccttacagaagacatagtctctttgacggag
gtcaactctgtgtacatcgtccaggagtacatggagacagacctttgtcagctgctggag
agggggcttttgtccgaagaccactccaggctcttcatgtaccagctgctacgaggcttg
aagtacatccactctgctaatgtactgcacagggacctgaagcctgccaacctgttcgtc
aacaccgaggacctggtgctgaagatcggggactttgggttggcccggatcatggaccca
cactactcacacaagggtcatctctctgagggtttggtgacaaagtggtatcggtctcct
cgcctgctgctctctccaaataactacaccaaggccattgacatgtgggctgccggctgt
atcttcgctgagatgctcaccgggaagactctgtttgcaggggctcatgagctggagcag
atgcagttaatcctggagtccatcccggtgctgagggaggaggaccggcaggagctgcac
aaggtcatccccgtgttcatacgcagtgacatgactcagccccacaaccctctggccaga
ctcctgccagacgtcagcccacaagccctggacttcctggagaagatcctgacctttaac
cccatggaccgcctgactgcagaagaggccctagctcacccgtacatggctgactactcg
tttcccctggacgagccggtctccctccatccgttccacatagaggatgaggtggatgac
atcctgctaatggaccagagtcacagtcacacctgggacaggtaccgggacagtcagctg
tcggagggagactggcacctacacactcacagcaccctggaccccgacgaggtgcaggtg
gacccccgggccctgtctgacaatacggacgacgaggacgtccaggtggaccctcgtaag
tacacagacggagaccgggagaagttcctggatgatccctcctacgactacacctccctc
ttcccccctgagcgctcgtggcccgacgaggacgacctccaccacgagaacaagtactgt
gacctggagtgttcgcacacctgcaactacaaggccacgtctccgtcctacctggacaac
ctgatcctgagggacagcgtggtcaaccactactacgagcccaagctcatcatcgatctc
tccaactggaaggagcagcagaacaaggagaagctagccgtcgacaaagagcgcaaggcc
cagaagagcaagtgcgaaaagaacggcctggtcaaggcccggatggcccttcaggaggct
gagaagtcccacagtcctgaggagaaggactcccagcaggagaagaaccagaaccacacc
gcccagcagagccaaggcttcgattttgactctttcatagccggaaccatcaaactcagc
ctacagcctgaaccaagcgaggtgggcctcctgagcgaggtgggcctgctgagcgaggtg
ggcctgctgagcgaggtgggcctgctgaacgaggtgggtctgctgaacgaggtgggcgtg
agcctgctgagtgaggtgggcctcctgaacgagctcaattcgtccgtgtcccagttggag
gcttcgcggtcaggctccatgtccaagtccatcagccaggagaaagaggagaaatgtttg
gtgaacttcgctcaggtcagcagcaccgtggggactaccgggtctggacagcgtcccgct
cacccctgggagagctttggaggtggggagcgggtggaggaagggaggggtgggtgtctg
atcgacgaggcagggcgctgggacgtcgggaaagaggagcagctccagaaggagagctcg
tacaccagctacctggacaggctgttcagcaagaaggacgaagggtgcggggagagtgct
gccagtgcctccgacagctcagagccagagccgtcggaggcgggaggggagcgggacgag
gggggcttcctggcgaggagcggggaaattatgtttaacatgcagctggactctctggct
ctgccaaggttcgacgctaccgcagacctgccactgaaatccatccaggcctccctcgcc
ccctccgctgtccgatgctcgccgcagatcgcccacaagacctacagcagcatcttcaag
catctgaattga

DBGET integrated database retrieval system