KEGG   Esox lucius (northern pike): 105025414
Entry
105025414         CDS       T04894                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
els  Esox lucius (northern pike)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 105025414
NCBI-ProteinID: XP_010894366
LinkDB
AA seq 293 aa
MSLVFSIVTLYLCYNWAVVDAFLFLDCRFTCHYRCRALIQLDCSLDRSSIVEQTCVLVEH
TIETDTNVDEQVESGKQQELSVAEIQQKVKEYNAQINSNLFMNLNKDGSYTGFIKVQFKL
VRPVSVPPPRKGTATQDSVCKKSGVKRRTSFYLPKDTSKHLHISSRTRAREVIEALLKKF
TVVDNPGKFALFERTERHGQVFLRKLSDEECPLHLRLCAGPNEKTLSLVLKENETGEVNW
DAFSMPELKNFLRMLQREEEEHVKQIMQRYALARTRMQEAQAATSASGGSTPG
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtccctagtgttttccattgttacgctatacctttgctacaactgggctgttgtagat
gctttcctcttcttggattgcagattcacatgtcactacagatgtcgagctcttatccag
cttgattgcagtttggatcgtagctccatagttgaacaaacatgtgttttggtcgaacac
accatagagaccgatacaaatgtggatgaacaggtcgaatcagggaagcagcaggagctg
tcagtcgcagagatacagcagaaggtcaaggagtacaatgctcaaatcaacagcaacctg
ttcatgaacctaaacaaagatggctcctacactggcttcataaaggtccagttcaagctt
gtacggcctgtgtcagttcccccaccaaggaagggtactgcaacacaggatagtgtgtgc
aagaaaagtggagtgaagcgtcgcacctctttctacctgcccaaggatacttccaaacac
ctacacatcagctcccgcacacgcgctcgagaggtcatcgaagctttactgaagaagttc
accgtggtggacaaccctggcaagtttgctttgtttgagcgcactgagcgccatggccaa
gtgttcctgcgtaagctgtcagatgaagagtgtcccctccacctgcgtctgtgcgctgga
ccgaacgagaaaacactcagtttggtattgaaggagaatgagactggagaagtcaactgg
gatgccttctctatgccagagctaaagaactttctccgcatgctacagcgtgaggaggag
gagcatgtcaagcagattatgcagcgctatgctctagcacgcaccaggatgcaggaggcc
caagctgccacttctgcctctggtggttccacaccaggctga

DBGET integrated database retrieval system