KEGG   Esox lucius (northern pike): 105025907
Entry
105025907         CDS       T04894                                 

Gene name
kif3a
Definition
(RefSeq) kinesin-like protein KIF3A isoform X1
  KO
K10394  kinesin family member 3A
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105025907 (kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:els04812]
    105025907 (kif3a)
Cytoskeleton proteins [BR:els04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     105025907 (kif3a)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF812 PIF1 Fez1
Other DBs
NCBI-GeneID: 105025907
NCBI-ProteinID: XP_010895261
LinkDB
AA seq 730 aa
MPSNKMDKPEIMDNVKVVVRCRPLNQKEKSMGHKQAVSVDENRGTITVNKLETTHEPPKT
FTFDTVFGPDSKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVPELR
GIIPNSFAHVFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQMQRLEVKERPDVGVY
IKDLSGYVVNNADDMDRIMTMGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNQH
VRMGKLHLVDLAGSERQGKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEISGSEGSGSEEMDEGDDEGREGHRRRRGSGSSISSSDSACS
SIAPQAPEEKPKPQTKERGKKKVSPDKMVEMQAKIEEERKELEAKLDMEEEERNKARAEL
EKREKDLLKAQQEHHLLLEKLSALEKKVIVGGVDLLAKAEEQEKLLQESNNELEERRRRA
EQLRRELEEKEAERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHHREI
EGLLENIRQLSRELRLQMLIIDNFIPQEYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRK
QTPVSDKKEKDPFEVDLSHVYLAYTEESMRQSLMKLERPRTSKSGKSGRPKTGRRKRSAK
PEAVIESLLQ
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgccgagtaacaaaatggacaagccagagatcatggacaacgtcaaagtggtggtgcga
tgtcggccgctgaatcagaaggagaaaagtatgggccataaacaggcggtcagtgtggac
gaaaaccgagggaccataaccgtcaacaaattagagactacccacgaacctcccaaaacc
tttacattcgacacagtgtttgggcctgacagcaaacagctggatgtttacaaccttact
gcccgacctatcatagactctgtattagagggttacaatgggaccatctttgcgtacgga
cagacggggacgggaaagacgttcactatggagggagtgagggcggtgccagagctccga
ggaataatacccaactccttcgctcatgtgttcggccacatcgccaaagcagagggtgac
acccggttcttggttcgcgtctcttatctggagatttacaatgaggaagtgagggacttg
ttgggcaaggaccagatgcagaggttggaggtcaaggagaggccagatgtgggcgtttac
atcaaggacctgtctggttatgtggtgaacaatgctgatgacatggacaggattatgaca
atgggacacaagaaccgctcggttggtgcaaccaatatgaacgagcacagctctcgctct
cacgccatcttcaccattaccattgagtgtagcgaaaagggagtggacggaaatcaacat
gtccgcatgggaaaactccacctagtggatttggcgggttctgagcgacaggggaagacg
ggagctacaggccagcggctgaaagaggccactaagattaacttgtctctttccacgctg
ggtaatgtcatctcagctctagtggatgggaagagcacccacgtcccatacaggaactct
aaactcacccgcctgctgcaggactctctggggggaaactccaagaccatgatgtgtgca
aacattggcccagcagactacaactacgacgagaccatcagcacactgcgctatgctaac
cgggccaaaaacattaagaacaaagccagaatcaatgaagaccccaaggatgccctctta
cggcaattccagaaggagatcgaagagctcaagaagaaactggaagaaggagaggagatc
tctgggtcggagggaagtggatcagaagagatggatgaaggagatgatgagggaagagag
ggacacaggagacggagaggcagtggcagcagcatcagtagctcagactctgcctgctcc
tctattgcgccacaggcccctgaggaaaaacccaagccccagactaaagaacgagggaag
aagaaggtttctcctgacaagatggtggagatgcaggcaaagatcgaggaggagaggaag
gagttggaagccaagctggacatggaagaggaggagaggaacaaggcccgggcagagctg
gagaagagggagaaagatctcctgaaagcacagcaggagcaccacctgctactggagaag
ctatcagccctggagaagaaggtgattgttggaggagttgaccttctggccaaggctgag
gagcaggagaaactattgcaggagtcaaacaatgagctggaggagcggcgcaggagggct
gagcaactccgcagagaactggaagagaaggaggcggagcgtctggacattgaggagaag
tacacaagtctacaagaggaggcccaggggaagaccaagaagctgaagaaagtctggacc
atgctgatggctgccaagtctgagatggccgacctgcagcaggagcatcaccgagagatc
gagggcctcctggagaacatccgccagctcagcagggagctccggctgcagatgctcatc
atagataacttcattccgcaggagtaccaggagatgatcgagaattacgtgcactggaat
gaggacattggagagtggcagctgaaatgtgtagcttacaccggcaacaatatgagaaaa
cagactcctgtgtcggacaagaaagagaaagacccgtttgaggtggacctgtcccacgtg
tacttggcctacacagaggagagtatgagacagtcactgatgaagctggagaggcctagg
acctccaagagtggcaagagtggccggcccaagactggacgaaggaaaaggtcagcgaag
cccgaggctgtgatcgaatccctgctgcagtga

DBGET integrated database retrieval system