KEGG   Esox lucius (northern pike): 105025958
Entry
105025958         CDS       T04894                                 

Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105025958
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105025958
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:els03310]
    105025958
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    105025958
Nuclear receptors [BR:els03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   105025958
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 105025958
NCBI-ProteinID: XP_010895350
LinkDB
AA seq 784 aa
MSVSSATTTSVFLPSSPLMQPGDVPNGLSNPPSREDVTSASITATASGGLYLEDPETPNI
ETPKVSTKDQRAQAQNLVFPPQQTNTSLGLGLFTLGETFSCLEASIADLNRSSPSMDSLI
GGSDPNLFPMSTRTETDFNRDQDPMDLDQDGYIGKDQKLFNDNTMDLLQDFELTGSPSDF
NVGDDEFLYSLADGSLLGDDSQDRGIPNPSSKQTTTTNIGGGILSGSNSTTLNGSLLTRQ
DESSSGTPATGNNPATPSATFPIVKMEKDTGFIQLCTPGVIKQEKNSTSHSYSCHMTSGT
GGSASSSGLSSNSPISICGVSTSGGQSYHFGVTSSSNPPTVNVSASDAAGASQQKDRKPP
VFSLYPSLGTAGEAWNSRSYGDGGLSSLPSNFSSSYASSNPRQDGGALTNTTTQAKAGTI
HKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGTLARGQHNYLCAGRNDCIIDKIRRKN
CPACRFRKCLMAGMNLEARKTKKLNRLKGLQQPVEPAPTPLPEARSLVPKSMPQLIPTML
SLLKAIEPETIYSGYDGTLPDTSTRIMTTLNRLGGRQVISAVKWAKSLPGFRNLHLDDQM
TLLQCSWLFLMSFGLGWRSYQQCDGNMLCFAPDLVINEDRMKLPYMADQCEQMLKISSEF
VRLQVSHDEYLCMKVLLLLSTVPKDGLRSQAVFDEIRMSYIKELGKAIVKREENSSQNWQ
RFYQLTKLLDSMHEMVGGLLNFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLL
FHQK
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgtctgtttcctctgcaaccaccacctctgtgtttcttccatccagcccacttatgcaa
ccgggcgacgtgcccaacggactcagcaaccctccgtcacgtgaagacgtcacttcagcc
tccataacggccaccgcatctggggggctctaccttgaagacccagagactccaaacata
gagacccccaaggttagtaccaaggaccagcgagctcaggctcagaatctagtgttcccg
ccccagcagaccaacacctccctggggttaggactttttactcttggggagaccttctcc
tgcttggaagctagcatcgcagacctcaaccgctcctcaccaagcatggattccctgatc
gggggctcggaccccaaccttttccccatgtccacaaggacggagacagacttcaaccgg
gaccaggaccctatggatctggaccaggatgggtacattggaaaagatcagaagctgttc
aacgacaacaccatggatctcctccaggactttgagctaacaggctccccctcagacttt
aacgttggggacgatgagttcctttactccctggctgatgggtctctcctgggggatgac
agccaggatcgtgggattccaaaccccagctccaagcaaactactacaaccaacattggg
ggtggtattttaagcggttccaacagcaccacattgaatggtagtctactaacacgtcag
gatgaatccagctccggcacgcccgcaaccggcaacaaccctgccaccccatccgccacc
ttccccatagtgaagatggagaaggacactgggttcatccagctgtgtactccaggtgtg
atcaagcaggagaagaactcgacctcgcatagctactcctgccatatgaccagcggtacc
gggggatccgcttcctcctcagggctctccagcaacagcccgatctcaatctgtggtgtg
agcacctccggaggacagagctaccactttggagtcaccagcagtagcaacccccccact
gtcaacgtctccgcttctgacgccgccggagcttctcaacagaaggatcggaagccacct
gtgtttagcttgtatccttcgctggggactgcgggcgaggcctggaacagccggagttat
ggggacggaggcctctccagcctgccctccaacttctccagcagctatgccagttccaat
cccagacaggatggcggggctttgacgaatacaacaacccaggccaaagccggcaccatc
cacaagatctgtctggtgtgttcggacgaggcgtctggctgccattacggggttctcaca
tgcggaagctgtaaggtgttcttcaagagagccgtggaaggtacgctggcaagggggcag
cacaactacctgtgtgctgggaggaacgactgcatcattgacaagatcagaaggaagaac
tgcccagcgtgccgctttcgcaaatgtctcatggcggggatgaatttggaagctcgtaaa
acgaagaagctgaaccgtttaaaggggcttcaacagcccgtggagccggcgcccaccccc
ctcccagaggccaggtcgctggtgcccaagtccatgcctcagctcatcccgaccatgctg
tctctactgaaggccatcgagccggaaaccatctactccggctacgacggcacgctgccc
gacacctccacgcgtatcatgaccacactcaaccggctgggggggcgacaggtcatatca
gccgttaaatgggccaagtccttgccaggtttccggaaccttcacttggatgaccagatg
accctactgcagtgctcctggctgttcctcatgtccttcggcctgggctggagatcctat
cagcagtgtgacggaaacatgctctgctttgctccagacctcgtcatcaacgaggaccgt
atgaagctgccctacatggcggaccagtgtgaacagatgctgaagatctccagtgagttt
gtgaggctgcaggtgtctcatgacgagtacctgtgtatgaaagtgctgctcctcctcagt
acagtgccaaaggatggtctgaggagccaggcggtgtttgatgagatccgtatgtcctac
atcaaggagttgggcaaggccatcgtcaagagggaggagaactccagccagaactggcaa
cgtttctaccagctcaccaagctgctggactccatgcacgagatggttggtggactgcta
aacttctgcttctacacgttcgtcaacaagtccctgtcggtcgagtttccagagatgttg
gcagagatcatcagcaaccaattaccaaaattcaaagctgggagtgtcaagcccctcctt
ttccaccagaaatga

DBGET integrated database retrieval system