KEGG   Esox lucius (northern pike): 105026147
Entry
105026147         CDS       T04894                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog B
  KO
K23663  modulator of smoothened protein
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105026147
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB
Other DBs
NCBI-GeneID: 105026147
NCBI-ProteinID: XP_010895710
UniProt: A0A3P8XHM2
LinkDB
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaattaacaattatatcaggatgtttgtttctggcagcggatatctttgcaatc
gccagcattgcaaacccggactggatcaacacaggcgaatctgcaggtgccctgacggtg
ggcctggtgcggcagtgtcaaaccatccatggacgggaccgcacctgtatccctccgcgg
ctgccccctgagtgggtcaccacgctgttcttcatcatcatggggatcatctctctcact
gtgacctgcggcctgctggtggcatcccactggcgtcgcgaggccaccaagtacgcccga
tggatcgccttcactggaatgatcctgttctgtatggcagcgctcatcttccccatcggc
ttctacatcaacgaagtgggaggccagccgtacaagctgcccaacaacacagtggtgggt
tcctcctacgtcctgtttgtcctctccatcttcttcaccatagtgggactacttttcgcc
ggcaaggtgtgtctgcccggctga

KEGG   Esox lucius (northern pike): 105031513
Entry
105031513         CDS       T04894                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog B isoform X2
  KO
K23663  modulator of smoothened protein
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105031513
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl 7tm_3 Cyt_bd_oxida_I LtrA TctB
Other DBs
NCBI-GeneID: 105031513
NCBI-ProteinID: XP_010904303
LinkDB
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGDAAGSLTVGLVRQCQTIHGRERTCIPPR
LPPEWVTTLFIIILGIISLTVTCGLLVASHWHREATRYARWIAFSGMILFCMAALIFPIG
FYIDEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaactcacaatcatatcaggatgtctttttctagcagcagatatctttgccatc
gccagtattgcaaatccagactggatcaacacaggagatgcagctggttctctgacggtg
ggcctggtgcggcagtgtcagaccatccacgggcgggaacggacctgcatccccccgcgg
ctgccccctgagtgggtcaccaccctcttcattatcatcctgggcatcatctccctcacg
gtgacctgcggcctactggtggcgtcgcactggcaccgagaggccacccgatatgcccgc
tggattgccttttctgggatgatcctgttctgcatggcggctctaatatttccgatagga
ttttacatcgacgaggttgggggtcagccttacaaactacccaacaacacagtggtcggg
tcctcgtatgtactttttgttctctcaatatttttcactatagtgggactcctctttgca
ggcaaggtctgcttgcctgggtga

DBGET integrated database retrieval system