KEGG   Esox lucius (northern pike): 105026178
Entry
105026178         CDS       T04894                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X3
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
els  Esox lucius (northern pike)
Pathway
els04114  Oocyte meiosis
els04120  Ubiquitin mediated proteolysis
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105026178
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105026178
   04340 Hedgehog signaling pathway
    105026178
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105026178
   04218 Cellular senescence
    105026178
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:els04121]
    105026178
   03036 Chromosome and associated proteins [BR:els03036]
    105026178
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     105026178
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     105026178
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2
Other DBs
NCBI-GeneID: 105026178
NCBI-ProteinID: XP_012989050
LinkDB
AA seq 529 aa
MEPEVEDKTLELMNTAVMESQNLVDDLSPKKTTVLTKLSNGPLMTGSRKRPSEGNYDREK
EQCMALFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAE
NILSFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFK
NRTTEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDEKI
ISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVTSGEVL
NTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDD
KYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG
ACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSG
RVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQSEGRSPSRTYTYISR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggagccggaggtggaggacaaaacgttggaattaatgaacacagcagtcatggagtcc
cagaacctggtagacgacctctcgccaaagaagaccacagttctcaccaagctcagtaat
ggccctttgatgacgggctcccgcaagcgcccgtcagaggggaactacgaccgggagaag
gagcagtgtatggccctatttgaccagtggtctgaggcggaccaggtggagtttgtagaa
caccttatctcgcgcatgtgtcactaccaacacggtcacatcaactcttacctcaagccc
atgctgcagagagacttcatcacagccctgccagcccagggcctggaccacatagcggag
aacatcctgtcgttcctggatgcacggtctttgtgctcggcggagctggtctgtaaggag
tggcagagggtcatctcagagggcatgctctggaagaaactcatagaacgcatggtccgc
acagatcccctgtggaaaggcttgtcggaacggcaccaatgggagaaatatctgttcaaa
aaccgcacaacagaagtcccgcccaactcctactaccactccctctaccccaagatcatc
caggacatagagactatagaggcaaactggcggtgtggtagacacaacctgcagaggatc
cagtgtcgctcggagaacagtaaaggagtctactgcctccagtacgacgatgagaagatc
atcagtggacttagagacaactcaataaagatctgggacaagcagtctctggagtgtctg
aagatcctgactggtcacacgggctcagtgttgtgtcttcagtacgatgagagggtcatt
gtcaccggctcctcggactccactgttagggtttgggacgtgacctcgggtgaggtgttg
aacactctgatccaccacaacgaggccgtgctccacctgcgtttctgtaacggcctgatg
gtgacgtgttccaaagaccgctccatcgccgtgtgggacatggcctcacccaccgacatc
agccttcgccgggtcctggtggggcaccgcgccgccgtcaacgtggtcgacttcgacgac
aaatacattgtgtccgcgtcgggcgaccgcaccatcaaggtgtggagcaccagtacgtgt
gagtttgtgcgcacgctgaacgggcataagagaggcatcgcctgcctgcagtacagagac
cggctggtggtcagcggctcctcagacaataccatacggttatgggatattgaatgtgga
gcatgtttgcgagtgttggagggtcatgaggagctggtccgttgcattcgcttcgacaac
aaaaggattgtcagtggagcttatgatggtaagataaaggtgtgggacctccaggctgcc
cttgacccccgagccccagccagcaccttgtgtctccgcacactggtggagcattcgggg
cgcgtgttccggctgcagtttgacgagttccagatcatcagcagttcccatgatgacact
atcctcatctgggacttcctgaacgtgtcgaccaatggacagtcagagggccggtccccc
tcacgcacctacacctacatctccagatag

KEGG   Esox lucius (northern pike): 105029256
Entry
105029256         CDS       T04894                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
els  Esox lucius (northern pike)
Pathway
els04114  Oocyte meiosis
els04120  Ubiquitin mediated proteolysis
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105029256
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105029256
   04340 Hedgehog signaling pathway
    105029256
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105029256
   04218 Cellular senescence
    105029256
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:els04121]
    105029256
   03036 Chromosome and associated proteins [BR:els03036]
    105029256
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     105029256
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     105029256
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 105029256
NCBI-ProteinID: XP_028976837
LinkDB
AA seq 526 aa
MEPEMEDKTLELMNTTFMDSQTDDFSSKKTTVFKTITNGPMTGSRKRPSEGNYEKEKDVC
IQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENIL
SFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRT
TEVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISG
LRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVLNTL
IHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYI
VSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACL
RVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVF
RLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSPSRTYTYISR
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaaacgttggagctgatgaacactactttcatggactcc
cagacagatgacttctcatcaaagaagaccacagtgttcaagaccatcactaacggcccc
atgacgggctccaggaagcggccgtcggaagggaactacgagaaggagaaggacgtgtgc
atccagctgtttgaccagtggtccgaggcagaccaggtcgagttcgtggagcacctgatc
tcgcgcatgtgccactaccagcacggccacatcaactcctacctcaagcccatgctgcaa
agggacttcatcaccgccctgccagctcagggtctggaccacatagcggagaacatcctg
tcgttcctggacgcccgctcgctctgctcggcggagcttgtgtgtaaggagtggcagagg
gtcatctcggagggcatgctctggaagaagctcattgaacgcatggtccgcacggatcct
ctgtggaagggcctgtcggagaggcaccagtgggaaaaatacctgtttaagaatcgaacc
acggaagtccctccgaactcctactaccgctccctgtatcccaaaatcatccaggacatc
gagacgattgaggccaactggaggtgtgggcggcacaatctgcagcggatccagtgtcgc
tcggagaacagtaagggggtttactgtctgcagtatgacgacgacaagatcatcagcggc
ctcagggacaactccataaagatctgggataagcagtcgctggagtgcctgaagatcctg
acgggtcacacggggtctgtgttgtgtcttcagtacgacgagcgggtcatcgtcaccggt
tcctcggactccaccgtcagggtgtgggatgtgaactccggggaggtgctgaacactctg
atccaccacaacgaagcggtcctccacctgcgcttctgcaatggcctgatggtgacgtgc
tccaaggaccgctccatcgccgtgtgggacatggcctcgcccaccgacattagcctgcgc
cgcgtgctggtcggccacagggcggcggtcaacgtggtggacttcgacgacaagtacatc
gtgtcagcgtccggagaccgcaccatcaaggtgtggagcaccagtacgtgcgagtttgtg
cgcaccctgaacggccacaagaggggcatcgcctgtctgcagtacagagaccggctggtg
gttagcggctcctccgacaacaccatccggttgtgggatattgagtgcggggcgtgtttg
cgggtgttggaaggccacgaagagttagtccgctgcattcgctttgacaacaaaaggatc
gttagcggcgcctatgacgggaaaatcaaagtctgggacctgcaggcagctctggaccct
cgtgcccccgccagcaccctctgcctgcggacactggtggaacactctggccgtgtcttc
cggctccagttcgatgagtttcagatcatcagcagttctcatgacgacaccatcctcatc
tgggatttcctcaacgtgtcgaccaatggacagactgagggccggtcgccctctcgcacg
tacacatacatctccagatag

DBGET integrated database retrieval system