KEGG   Esox lucius (northern pike): 105026437Help
Entry
105026437         CDS       T04894                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
els  Esox lucius (northern pike)
Pathway
els00350  Tyrosine metabolism
els01100  Metabolic pathways
Module
els_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    105026437 (gstz1)
Enzymes [BR:els01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     105026437 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 105026437
NCBI-ProteinID: XP_010896200
LinkDB All DBs
AA seq 220 aa AA seqDB search
MHISLSCLSKPILHGYFRSSCSWRVRIAFALKGIEFDQVPVNLIKDGGQQLTDQYKQLNP
MQQVPAVHIDGIILSQSLAVIQYLEETRPGPRLLPADPVKRAQVRMVSDIIASGIQPLQN
LCVLQKIGAEKAQWAQHFIQRGFEALEPILKETAGKYCIGDEISMADICLVPQVYNADRF
KVDVDQFPTIKRLNQTLMELDAFKVSHPSCQPDTPADMRA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcatatttcactctcttgcctttcaaagcccattcttcatggatatttcaggagttca
tgctcttggagagtccgaattgcttttgctctgaaaggaattgaatttgaccaagtccca
gtcaatcttatcaaagatgggggacagcagcttacagatcagtacaagcaattaaatcct
atgcagcaagtgcctgctgtccacattgacggcatcatcctgtcacaatcactggcagtg
atccagtacctcgaggagaccagaccaggacctaggctccttcctgccgacccagtgaag
cgtgcccaagtgcgcatggtctcggacatcatcgcctctgggatccagcccttgcagaat
ttgtgtgtgctacagaagataggagcagagaaggcacaatgggcacagcatttcatccaa
agagggtttgaagccctggagcctattcttaaagagacagctggcaagtactgcatagga
gatgagatctccatggccgacatttgtcttgtcccacaagtctataatgctgaccggttc
aaagtggatgttgatcagttcccaactatcaaaaggctaaatcaaaccttaatggagtta
gatgctttcaaagtgagtcatccatcttgccaaccagacacacctgctgacatgcgtgct
tga

DBGET integrated database retrieval system