KEGG   Esox lucius (northern pike): 105027876
Entry
105027876         CDS       T04894                                 

Gene name
gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04110  Cell cycle
els04150  mTOR signaling pathway
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
els04910  Insulin signaling pathway
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105027876 (gsk3b)
   04310 Wnt signaling pathway
    105027876 (gsk3b)
   04340 Hedgehog signaling pathway
    105027876 (gsk3b)
   04150 mTOR signaling pathway
    105027876 (gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105027876 (gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105027876 (gsk3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105027876 (gsk3b)
   04916 Melanogenesis
    105027876 (gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105027876 (gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105027876 (gsk3b)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     105027876 (gsk3b)
Protein kinases [BR:els01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   105027876 (gsk3b)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105027876 (gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 105027876
NCBI-ProteinID: XP_010898526
UniProt: A0A3P8XJV7
LinkDB
AA seq 425 aa
MSGRPRTTSFAESCKPAPQPSAFGSMKVSRDKDGSKVTTVVATPGQGSDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQVFRPRTPPEAIALCSRLLEYTPTSRLTPLEACAHSFFDELRDPNVKLPNGREK
PSLFNFITQELSSNPSLANILIPAHARSQAAASTPTNSNVTTDGNSTEHGPSTTSASASA
SNSTS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtctggtcggcccagaaccacctccttcgcggagagctgcaaaccagcgccgcaaccc
tcggcttttggctctatgaaagtcagcagggacaaagatgggagtaaggtgacaacagtg
gtagccactccagggcaagggtctgacaggccgcaggaggtcagctacacagacactaag
gtgattgggaacggctcgttcggcgtggtctaccaggccaaactgtgtgactctggagag
ctggtggccatcaagaaggttctgcaggacaagaggttcaagaatcgtgagctgcagatc
atgaggaagctggaccactgcaacattgtacgcctgcgctacttcttctactccagtgga
gacaagaaggacgaggtctatctcaacctggtactggactatgttcctgaaacggtctat
agagtggccaggcactacagccgagccaaacagaccctgcccatggtctatgtcaagttg
tatatgtatcagctgttcaggagtttggcctacatccactcctttgggatctgccatcga
gacatcaagccccagaacctcctgctggacccagagacagccgtgctcaaactttgtgac
ttcggcagtgctaagcagctggtacgtggagagcccaatgtgtcctacatctgctcccgc
tactacagagctcccgagctcatcttcggtgccaccgactacacgtccagcatagatgtg
tggtcagctggctgtgtgctagcagagctgttgctagggcaacccattttccccggtgac
agtggagtagatcagctggtggagatcattaaggttctggggaccccgacacgggagcag
atccgagagatgaaccccaactacactgagtttaaattcccgcagattaaggcccaccca
tggactaaggtgagtcaacaggtgttccggccgcgtacaccgcctgaggccatagccctg
tgctctcgtctgctggagtacacgcccacctcccgcctcacccccctggaggcgtgtgct
cactcgttctttgacgagctgagggaccccaacgtcaagctgcccaatggccgagaaaaa
ccctccctgttcaacttcattacccaggagttatccagtaatccctcactggctaacatc
ctaatccccgcccacgcccggtcccaggccgctgcctcaaccccaaccaactccaacgtc
acaacagatggtaacagcacagaacatggcccgagcaccaccagcgcctcagcctccgct
tccaactccacctcctga

KEGG   Esox lucius (northern pike): 105031009
Entry
105031009         CDS       T04894                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04110  Cell cycle
els04150  mTOR signaling pathway
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
els04910  Insulin signaling pathway
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105031009
   04310 Wnt signaling pathway
    105031009
   04340 Hedgehog signaling pathway
    105031009
   04150 mTOR signaling pathway
    105031009
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105031009
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105031009
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105031009
   04916 Melanogenesis
    105031009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105031009
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105031009
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     105031009
Protein kinases [BR:els01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   105031009
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105031009
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 105031009
NCBI-ProteinID: XP_010903478
LinkDB
AA seq 432 aa
MSGRPRTTSFAESCKAVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVSQQPCVIGSQVFRPRTPPEAIALCSRLLEYTPTARFTPLEACAHSFFDELRDPNLK
LPNGREKPLLFNFSTQELSSNPSLASILIPAHARNQPGASTPTNASAPSDTNSGDRGQIT
NAASASASNTST
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccagaaccacctcgtttgcagagagctgcaaggctgtgccgcagccc
tcagcatttggcagtatgaaagtcagtcgagacaaagatgggagcaaggtgaccaccgtg
gtggcaactccaggccagggacccgacaggccgcaggaggtcagctacacagacaccaaa
gtcatcggcaacggctcgttcggcgtggtctaccaggccaagctgtgtgactccggggag
ctggtggccatcaagaaggttctgcaggacaagaggttcaagaaccgggagcttcagatc
atgaggaaactggaccactgcaacatagtgcgtctgcgctacttcttctactccagtgga
gataagaaggacgaggtctacctaaacctggttctggactacgttcccgagacggtctac
agggtggccagacactatagccgcgccaagcagaccctccccatggtctatgttaagttg
tacatgtaccagctcttccggagcttggcctacatccattcctttgggatctgtcatcgg
gacatcaagccccagaacctgctgctggacccggagacggccgtgctcaagctctgcgac
tttggcagtgcgaagcagctggtccgcggtgagcccaacgtgtcttacatctgctcacgg
tactacagagcccccgagctcatctttggggccactgactacacctccagcatagacgta
tggtcggctggctgcgttctagcagaactgttgctagggcaacccattttccccggtgac
agtggggtggatcagctggtggagatcatcaaggttctcggcacccccactcgggaacag
atcagagagatgaatcccaactacaccgagttcaagttccctcagatcaaggcccatcca
tggactaaggtgagtcaacagccttgtgtgattggctctcaggtgttccggccgcgcacg
ccgcccgaggccatcgccctgtgctcgcggctgctggagtacacgcccaccgcacgcttc
acgcccctggaggcctgtgcccactccttttttgacgagctccgggaccccaacctcaag
ctgcccaatgggcgtgagaaacccctgctcttcaacttctccacgcaggaattgtccagt
aacccctccctagcctccatcctaatccccgcccacgctcgtaatcagcccggggcctcc
acccctaccaatgcctccgcaccctcagacaccaacagcggtgaccgtggccagatcacc
aatgctgcctctgcctctgcttccaacacatccacctga

DBGET integrated database retrieval system