KEGG   Esox lucius (northern pike): 105028060
Entry
105028060         CDS       T04894                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
els  Esox lucius (northern pike)
Pathway
els04141  Protein processing in endoplasmic reticulum
els04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105028060
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105028060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105028060
Transcription factors [BR:els03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105028060
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU DUF4140 CENP-H FapA DUF724 SlyX
Other DBs
NCBI-GeneID: 105028060
NCBI-ProteinID: XP_012988138
UniProt: A0A3P9ADH3
LinkDB
AA seq 697 aa
MTTDLLSDLDSRFFADNLLTSEDWDACLYQCESMEEGEDVEYTRGLKYETSFDSDLVLTL
DPDNPTSPWRHLDDNLLTGDSPVLKDEMTITQPLPVDMLFQVKAEPPSPASSLDSDCSIT
SLPDSQITVKGENPPTPPYMFGDVLSPPLGSCEVTVASQSQPTTALHAADPLAQSTVQPT
ATTIKATSILSSKPPIQPRPVCVAALPVPQGPSPAKALILHSLPAMDQNRPVVLSQSVCL
GSAPAIVKMEPVSPPMPHCHSPTAPFPSKPIVPASSLPGSNCHDIDVSVCQSRVSQSMKV
MKRQQRMIKNRESACQSRKKKKEYLQNLEGQLREAQQENERLRRENQALRERLAGKEGSE
SGNNKRAVCVMAVLLFMTFSFGPVSIIDRKLETGFQEAAVPQSRRHLLEFDTAQEHSRVE
ERTDHEEDGGEDRWKGEVERDSADSYQFRNLSDVFSDVKDLVLQDIDRYFTSNDCRQFNR
SESLRLADELRGWVHRHQIDRKKSGGKPKIVKKAKIAQKAQLRKTNFSRYLPIQSHRSIE
SQLQVFPAGPEISYSDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRPKMSLVMPAM
SVNESLYNKSQGFEMMMQVDCEVMDTRIIPIKASAVPPSLRDPPPAPPATHHHHHHSNHT
SLRGRHHPHAGGGAPPRQPLPVGRQEAEYFISQGGGV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggatagtcgtttcttcgctgataatctgctgaca
agcgaagattgggatgcctgtctttaccagtgtgaaagcatggaggagggtgaggacgtg
gagtacacgagaggacttaaatatgaaacatcgtttgacagcgatcttgtgctgactctt
gatcctgacaatcccacatcaccatggagacacctggacgacaaccttcttacaggggac
agtcctgtattgaaagacgaaatgaccataacgcagcctctgccagtggacatgttgttc
caggtgaaagcggagcctccctctcccgcctcttcactggactcggactgctccataacg
tcgctcccagactcccagattacggtgaaaggggagaaccctcctacgcctccctacatg
tttggggacgtgctgtccccgccgctcggctcgtgcgaggtcacggtggcgtcccagtcc
cagccgacgacagccctccacgcggctgacccgctggcccagtccacagtccaacccaca
gcgaccacaatcaaagccactagcatcctgagcagtaagcctcccattcagcccaggcct
gtgtgtgtcgcggcgctgcccgtcccccagggcccgagcccagccaaggccctcatcctg
cacagcctgcccgccatggaccagaaccggcccgtggtgctttcccagtcggtctgtctt
gggtcggctccggccatcgtcaaaatggagcctgtctctccccccatgccccactgccac
agccccacggccccgttccccagcaaacccattgtcccagcatcctctctgcccgggagc
aactgccatgacatcgatgtgagtgtctgtcagtcacgtgtcagtcagtcaatgaaggtg
atgaagaggcagcagcggatgatcaagaaccgggagtcggcgtgccagtcgcgcaagaag
aagaaagagtacctgcagaacctggaaggccagctgagggaggcgcagcaggagaacgag
cgcctccgcagggagaaccaggccctgagggagaggctcgccgggaaggagggaagtgag
tctggcaacaacaagagggccgtatgtgtcatggccgtgctgctcttcatgaccttcagt
ttcggccctgtcagtatcatagacaggaagctggagacggggtttcaggaagcggcggtc
cctcagtcgaggagacatctcctggagtttgacacggctcaggagcacagcagagtggag
gagaggaccgaccacgaggaggatggaggagaggacaggtggaagggagaagttgagagg
gattctgctgattcgtaccagttcaggaacctgagtgacgtgttcagcgacgtgaaggac
ctggtccttcaggacatcgaccgctacttcacctccaacgactgcaggcagttcaaccgc
tctgagtccctcaggctggctgatgaactacgaggatgggttcaccggcaccagatcgac
aggaagaagtctggagggaagccaaagatagtgaaaaaagccaaaatagctcagaaagca
cagctgaggaagacaaacttctccagatatctgcccattcagagccatcggtccattgaa
agtcagttacaggtgttccctgcaggtccagagatcagctacagtgacttcatggacgcc
atcgaccggcgcgaggacacattctacgtggtctccttcagaagggatcacctgctgttg
ccggccatcagccacaataagaccacacggcccaagatgtctcttgtgatgccggccatg
tctgttaacgagagcttatataacaagtcccagggcttcgagatgatgatgcaggtggac
tgtgaggtgatggacacgcggatcatccccatcaaagcctcggccgtccccccgtccctc
cgcgacccccctccggctccgcccgccacgcaccaccaccatcaccacagcaaccacacg
tccctccgcggccgccaccacccccacgccggcggaggggcgcccccgcggcaaccctta
cctgtcgggagacaggaggccgagtatttcatcagccaggggggcggggtttga

DBGET integrated database retrieval system