KEGG   Esox lucius (northern pike): 105028118
Entry
105028118         CDS       T04894                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
els  Esox lucius (northern pike)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 105028118
NCBI-ProteinID: XP_010898935
UniProt: A0A3P8XWW6
LinkDB
AA seq 388 aa
MLNMGSEPPQAVSRLFAWVNGMSKCELIELKDLSLNDRIELAPDPPAPLLPPAPLTPRQV
RALERPSQAVRMTGDSVSVEGPSWFPGQGGKGHDFQPCSYTQIAWCDLCGEFIWSLYKLS
LSCVNCSYTCHHHCRPYIQLDCSTDSRLLPTDETDVSDDIVETDTNVDVIEPIDWGKQVL
SLGDIQQKVKEYNAQINSNLYMVLNRDGSYTGFIRVVFKLTRPVSLPSPAKTSPQLEEGQ
QERGLRRRTSFYLPKGTAKHLHISSRTRAREVIEALLNKFTVVDNPAKFALFERSERQNQ
IYLRKLSDDERPLHLRLCAGPNEKVLSLVLKENETGEISWDAFSFPELRNFLQILQREEE
EHVRQIIKRYALTRDKMKEALASGTAPG
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgctaaacatgggtagtgaacccccccaggcagtttcccggctgttcgcctgggtcaac
gggatgtccaagtgtgagctgattgagctgaaggacctcagcctgaatgatcgaattgag
ctggcaccagacccaccagcacctctgctccctccagcgcccctgactcccagacaggtg
agggctctggagaggcccagtcaggcggtccggatgacgggggacagtgttagtgttgag
gggccctcgtggttcccagggcagggtgggaagggacatgacttccagccttgcagctat
actcagatcgcatggtgcgacctttgtggagaattcatttggagcctctacaaactgagc
ctgagctgtgttaactgcagttacacctgtcaccaccattgtcgaccttatatccagttg
gattgcagcacagacagtaggctcctccctactgatgaaacagatgtttctgatgacatt
gtagagactgataccaatgtggatgtgattgaacctatagactgggggaaacaagtgctt
tctctcggtgacatccagcagaaggtaaaggaatacaacgctcagatcaacagcaatctc
tacatggtgctgaaccgagatggatcatacactggcttcatcagggtcgtttttaagcta
actcggcccgtgtcacttccgtcccccgcaaagacatccccacaactggaggagggccag
caagaacgggggctgaggcgccggacctccttctacctccccaaaggcacggctaaacac
ctgcatattagctcacggacacgggcacgagaagtcatagaggccctgctcaataagttc
acagtggtggacaaccctgccaagttcgccctgtttgaacgcagcgaacgtcaaaaccag
atatatctccgtaagctgtctgatgacgagcgtccgcttcacctgcgtctttgtgccgga
cccaatgagaaggtcctcagtctggtgttgaaagagaatgaaaccggggagatcagttgg
gatgccttcagctttcctgagttgcgcaatttcctgcagatccttcagcgcgaggaagaa
gaacacgtccggcagataatcaagcgctacgctcttacgagggataagatgaaagaggcc
ttggctagtggtaccgcccctggctga

DBGET integrated database retrieval system