KEGG   Esox lucius (northern pike): 105028748Help
Entry
105028748         CDS       T04894                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
els  Esox lucius (northern pike)
Pathway
els00052  Galactose metabolism
els00500  Starch and sucrose metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105028748
   00500 Starch and sucrose metabolism
    105028748
Enzymes [BR:els01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     105028748
    3.2.1.20  alpha-glucosidase
     105028748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 105028748
NCBI-ProteinID: XP_010900006
LinkDB All DBs
AA seq 1807 aa AA seqDB search
MVKKKFSGLEVSLIVMLLLVMTVAVALIVLMVTGEPAVIKEETIVPECPNIPLAERVNCF
PDAGASKSACQMRGCCWSPLDERNVPWCFFSTNHGYSLVSEERPNSHSLSARLKRMAAPS
LFGSDIEELSFLAEMQTVNRLRFKISDPLSKRFEVPHEHVRDHVTQVPGSLNYEIELTHK
PFSLKVRRAATKKVLFDTAVGPLVFADQYLQLSARLPSHNIYGLGEHVHQNYRHDTMWKT
WPIFTRDAFPNGGTHNLYGHYPYFLCLEDESGKSFGVFLMNSNAMEVTLQPAPAVTYRTI
GGVLDFYILLGDTPEQVVQEFLELIGRPVIPPYWSLGFQLSRWDYGSLDEVKKTVERNRA
IGIPYDVQYTDIDYMEDKKDFTYDLVKFRDLPSFAEYLHSKGQKYILILDPAVATSPRIN
GPYESYDRGTKKEAWVTEADGKTPIVGEVWPGETVFPDYTNKDCIEWWADEYERFSKEIK
HDALWIDMNEVANFKKGSIKGCADNKLNYPPFTPNILDGVMYSKTLCMDSKQAWGDHYDV
HSLYGYSMVLATDVALKRVFGTKRTLMLTRSSFPGVGKYSGHWLGDNAANWNDIKWAIPG
MLDFGLFGVPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQHYMPQDPAAFGEN
SLLVNSSRHYLNIRYTLLPYLYTLFYKAHTAGDTVVRPVMHEFYSDRRTWTVDRQFLWGK
SLLITPVLDPGVDRIRAYIPDAVWYDYETEVRMEARKQEVEMFLPADKLGLHIRGGAILP
IQKPAVTTVHSRLNPLGLIIALDNNNAAGELFWDDGDSLETVGSGNYMHYQFSVRNGILT
MQVMHSGYSDPNNLRFENITVLGVIREPLTVHVTDGNNITTHPFTYDTYRQVLYLRGLEL
ILGQNYTVSWSQPEFERFDCYPEPDVDEAKCRARECIWEPSNIEHVPWCYFPEDYGYTAT
TVEEQPSGWSFDITRNTKLRSSARPESPDINTLRVEIKYHSADLLQFKIFDPTNKRYEVP
VPLTVPPNPETDETKRQYRVQIQANPFGIQVYRNSTGTLIWDSALPGFTFSDLFIQVSTR
LSSEYVYGFGETEHPTYKHNLGYHTWGMFSKDQPPGYKKNCYGVHPFYMGLEMTAHAHGV
LLLNSNAMDVTFQPTPALTYRTLGGILDFYIVMGPTPELVVQEYTNLIGRPVLPAYWSLG
FQLCRYGYANDTEIAELYSDMRAAGIPYDVQYADIDYMERQLDFVLDRQFLGLPALVDTM
RTEGMRFIFILDPAISGNETDYPAFERGKAEDVFIKWPKELSNDIVWGKVWPDLPDVKVN
ESLDWDTQVKIYRAYTAFPDFFMNKTATWWHREIADMYKNITFDGLWIDMNEPASFVHGT
VGEKCLGPAVYDNPPYMPPLESRERGLNHKTLCMNSQQHLSDGTPVKHYDVHNLYGWSQI
KPTYDAVLSVTGKRGVVVTRSSYPSSGKWSGHWLGDNYSSWDQLLKSIIGMMEFSLFGIS
YTGADICGFFNPAEYEMCLRWMQLGAFYPYSRNHNSKFNPRQDPVSWNASFAEASRDVLN
IRYSLLPYLYTLMFHAHNAGSTVIRPLLHEFVNDKNTWDIDRQFLWGPALLITPALDEGA
REVKGYIPDDRWYDFHTARAIGVRGQLVTMPTPLNHINLHVRGGYILPWQKPENNTRYSR
KNPLGLIVSLSDSGTAKGSLFWDDGEGIDTVGEGQYLLTLFTAASNTLTCHVTKNGLPEA
ERLTLGVVRVWGAGNVLITDIILRENSGTEKKITGSHNLDTQELIADATALSVRVDQGFT
LIWKTSI
NT seq 5424 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagaagttttcagggttggaagtttctctaatagtcatgctccttctggtg
atgacagtggctgttgctttaattgttctaatggttactggagagcctgcagtcatcaaa
gaagagaccattgttccagaatgtccaaatattcctctggcagaaagagtcaactgtttc
cctgatgctggtgcctctaagtcggcgtgtcagatgcgaggctgttgttggagcccgttg
gacgaaaggaatgttccgtggtgcttcttctcgaccaaccatggctactcccttgtcagt
gaggaaagacccaacagccacagcttatctgcacgtctgaagagaatggcagccccctca
ctatttggatctgacatagaagaactgtctttccttgccgagatgcagacagtcaaccga
ctcagattcaagatctcagatcccctaagtaagcgatttgaggttcctcatgaacatgtg
agggaccacgtcacgcaagtcccaggatcccttaactacgagatagagctcacacacaag
cctttcagcctgaaagtgcgcagggcagcgaccaagaaagttctgtttgacactgcagtg
ggtccgctggtgtttgctgatcagtacctgcagctgtctgccagattgccctcccataat
atatatgggctgggagaacatgtccatcagaactatcgtcatgacaccatgtggaagacc
tggccgatcttcacacgagatgcattccctaatggggggacgcacaacctctacggtcac
tacccctacttcctctgtctagaggacgagagcggcaagtcctttggggtgttcctaatg
aacagcaacgctatggaggtgactctacagccggctcccgcagtgacctacagaaccata
gggggagttttggacttctacatcctgctgggagatacacctgagcaggtggtccaggag
ttcctggagctcatcggaaggccagttatccctccatactggtctctaggcttccagttg
tctcgttgggactacggcagtcttgatgaagttaagaaaactgtggagaggaaccgagcc
atcggcataccatatgatgtccaatatactgatattgactatatggaggataagaaggac
ttcacttatgatctagtcaaattcagagatctcccttcgtttgctgaatacctgcattcg
aagggacagaagtatatcctcatattggatcctgcggtggccaccagtccaaggatcaat
gggccatatgagtcatatgaccgaggaaccaagaaggaagcctgggtcacggaggctgat
ggaaagaccccgatagtgggtgaggtttggcctggtgaaacggtgtttccagactacacg
aacaaagactgcatagagtggtgggctgatgagtatgaacggttctctaaggaaatcaaa
cacgacgctctgtggatcgatatgaatgaggtggccaactttaagaaaggatccatcaag
ggatgtgctgacaacaagctcaactaccctcccttcacaccgaatattctggatggggtg
atgtacagtaagacgctgtgcatggattctaaacaagcctggggggaccactatgatgtt
cacagtctttatggatactccatggttctagccacagatgttgctttgaagcgtgtgttt
gggacaaagcggacactaatgctgacccgctcgtccttccctggggtagggaaatactca
ggccactggttgggggacaacgctgctaactggaatgacatcaaatgggctatacctggc
atgctggactttggcctgtttggagtcccctatatcggtgctgatatttgcggtttcttt
gacaactcgactgaagagttgtgtcgtcgctggatgcaagtgggagccttctatcccttc
agccggaaccataacgcccaacattacatgccccaggacccggcggcatttggcgaaaac
tctctactggtgaacagctccaggcactacctgaatattcgatacactctgctcccctac
ctatacacactcttctacaaggcccacactgccggagacaccgtggtccggccagtcatg
cacgaattctactctgacaggcgcacctggacggtagaccgccagttcctttgggggaag
agcctgctcatcactcctgttctggaccctggagtggatcggatccgagcctatatccct
gatgctgtctggtacgattacgaaacggaagtgcgaatggaagcccgtaagcaggaagtt
gagatgttcctacccgcagataagcttggtttacacatcaggggtggagctattctccct
attcaaaaaccggcggtgacaactgttcacagtcgcctgaaccccttgggtctgatcatt
gcactggacaacaacaacgcagcaggggagttattctgggatgacggagattctctagaa
actgttggaagtgggaactacatgcactaccagttttctgttcgcaatggcattttgacc
atgcaggtgatgcattctggatacagtgaccccaacaacctgcgatttgagaacatcact
gttctgggtgtcatcagggaacctttgacagtccacgtaactgacggcaacaacatcaca
acacatcctttcacctatgacacttataggcaggtgctctatctgcgaggtctagaactc
atcctgggtcagaactatacggtaagctggagccagccggagtttgagcgcttcgactgc
tacccagagcccgatgtggatgaagccaagtgcagggccagggaatgcatatgggagccg
tctaacatcgaacacgtcccgtggtgctacttccccgaggactatggttacaccgccacc
acggtggaagagcagccttccggctggagtttcgacataacacggaacactaagctccgg
agcagcgcgagaccggaatctcccgacataaacacactcagagtggaaatcaaataccac
tctgcagacctgctgcagttcaagatctttgaccctactaacaagcgttatgaggtcccc
gtgcccctcactgttccccccaacccggagaccgatgaaaccaagaggcagtacagggtc
cagatccaggcaaatccttttggcatccaggtctacaggaacagcactggcacgttaata
tgggactcggcgttgccggggttcaccttctcagacctgttcatccaggtgtcgacgcgt
ctgtcgtccgagtacgtctacggcttcggggagactgaacaccccacatacaaacacaac
cttggttaccacacctggggaatgttttcgaaagaccagcctcctgggtacaagaagaat
tgttatggcgtgcacccattctatatgggtctggagatgactgcacatgctcatggtgta
ttactcctcaacagcaatgcaatggatgtgaccttccagccaaccccggccctgacttac
cgcacacttgggggaatcctggacttctacattgtgatgggacccacgccagagttggtg
gtgcaggagtataccaacctgattggacgtcctgtgctccctgcctattggtcccttggg
ttccagctctgtcgctatggatacgccaacgacacggagatagcagaactctacagcgat
atgagggcagctggcatcccctatgatgtgcagtatgccgacatagactacatggagcgc
cagcttgactttgtcctggatagacagttcctgggtctaccagccctggtggataccatg
agaacggagggcatgagattcatattcatactggaccctgctatctctggcaatgagaca
gactaccctgcctttgaacgggggaaggcggaagacgtattcatcaaatggcccaaagag
ctcagcaatgatattgtctgggggaaggtgtggcctgacctacctgatgttaaagtgaat
gagtctctagactgggacacgcaagtaaagatatacagggcctatacagcattcccagat
ttcttcatgaataagacggcaacatggtggcatcgggagattgcggatatgtacaaaaat
attacattcgacggcctctggattgacatgaatgaaccagccagctttgtccatggaact
gtaggagagaaatgcctgggtcctgctgtctacgacaatcccccatacatgccacccctg
gagtccagggaacgtggcctgaatcataagactctgtgtatgaacagccagcagcacctg
agcgacggcacgccagtcaaacactacgatgtacacaacctctacggatggtcccaaatc
aagccaacatacgatgccgtgttgagtgtaacagggaaacgcggtgttgtggtgacgagg
tcgtcctatccctccagtgggaagtggtctggacactggctgggagacaactactccagt
tgggatcagctcttgaagtccattataggaatgatggagttcagtctgtttggaatttct
tataccggcgctgatatctgtggctttttcaatccagctgagtatgagatgtgtcttcgc
tggatgcagctgggtgcattctacccttactctcgcaaccataacagcaagttcaaccct
cgacaagaccctgtgtcgtggaacgcatcgtttgccgaggcatcccgtgacgtgttgaac
atccgttactcactcctaccctacctgtacacactcatgttccacgcccacaatgcagga
agtacagtcatccgacctctgctacatgagtttgtgaatgacaagaacacctgggacatt
gaccgacagttcctctggggcccagctctgctcatcactccggccctggatgagggagcc
agggaggtaaagggttacatcccagatgaccgctggtatgacttccacacggctagggct
attggggtgaggggccagctggtaaccatgccaacgcctctcaaccacatcaacctccat
gtgagaggaggatatatcctgccctggcagaaaccagagaacaacacacgctacagtcgg
aagaatcccctggggctgattgtttccctgagcgacagtggcactgcgaaaggttccctg
ttctgggatgatggggaggggatcgacacggttggagagggtcagtaccttttgaccttg
ttcacagctgcttcgaacaccttgacctgtcatgtgacgaaaaatggtctgccagaggct
gagaggttgaccctgggcgtggtgagagtgtggggtgccgggaatgttctcatcacagat
attatcctacgtgaaaattcgggcacagagaaaaagataactggcagtcataaccttgac
acacaggagctgattgctgatgccactgccttatcagtacgcgtggaccagggcttcacg
ctcatatggaaaaccagcatttaa

DBGET integrated database retrieval system