KEGG   Esox lucius (northern pike): 105028856Help
Entry
105028856         CDS       T04894                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
els  Esox lucius (northern pike)
Pathway
els00512  Mucin type O-glycan biosynthesis
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    105028856 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:els01003]
    105028856 (wbscr17)
Enzymes [BR:els01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     105028856 (wbscr17)
Glycosyltransferases [BR:els01003]
 O-Glycan biosynthesis
  Mucin-type
   105028856 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin PurA RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 105028856
NCBI-ProteinID: XP_010900225
LinkDB All DBs
AA seq 598 aa AA seqDB search
MAFVFRRWRVLLVLNVIAVAGFMTFWTKCTHTRITKAVDQDDVKRQSRSNGTAQGSSISH
EVLLRRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGNGGLAATLAPSEEADAKVLREKYGY
NAYLSKKISLDRSIPDYRPSKCKKASFPRDLPNISLIFIFVNEALSVILRSVHSAVNHTP
AHLLKDIILVDDCSDDEQLKGPLEDYVNKRYPGLVKIVRNQKREGLIRARIEGWKAASGE
VTGFFDAHVEFTPSWAEPVLTRIKEDHKRIILPSIDNIKHETFEVERYENSGHGYNWELW
CMYINPPKQWWDEGDTSAPIRTPAMIGCSFVVNREYFGHLGLLDSGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIARMKKPYHSNIASSTRRNALRVAEVWMDQYKSHVYLAWNIP
MENHGIDYGDISQRVALRKSLQCKNFEWYLDNVYPEMRRYNNTLFYGEIRNSKATHLCMD
QGEKVNHTATLHPCHGMGPQLGRYTKGGQFFLGALGSTGEETRCLMDDQFSNFPQLLNCD
KVSNTRLTLWHFSQNDSIINRATGRCLEVIQANVYFGHALVLQTCSGQRWNIKNTVKQ
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgttcagaagatggagagtgttattggtgctgaacgtgattgcggttgcg
gggttcatgactttttggaccaagtgcacccacacccgtataacaaaagccgtcgatcag
gacgatgtgaaacgacagtcacgctctaacggcacggctcaaggttccagcatcagtcat
gaagtattactgaggagactcgggtcactggaggacgtggtctacagacagctcaatggt
ctgtcaaagtccctgggtctgattgagggctttgggggacgaggtaatgggggactcgcc
gccacactagccccatcagaggaggccgatgccaaagtcctaagggagaagtatggatac
aatgcttacctcagcaaaaagatatcactggaccggtccataccagactaccggccaagc
aagtgtaaaaaggccagcttccccagggatcttccaaacatctccctcatcttcatcttt
gtcaacgaagcgttgtcagtgattctccgctcagttcactcagctgtcaatcatactcca
gcacacctccttaaagatattatcttggtggatgactgcagcgatgacgagcaactgaaa
gggccgttggaggattacgtaaacaaacgctaccctggcttggtaaagatcgtaaggaac
cagaagcgagagggactcatccgtgcccgcatcgaggggtggaaggcagccagtggcgag
gtgacaggcttcttcgacgcccacgttgagttcacaccctcctgggctgagcccgttctg
accaggatcaaagaggaccacaagaggatcatcctgccctccatcgataacatcaagcat
gagacatttgaggtggagcgatatgaaaactctggccatggctacaactgggagctgtgg
tgcatgtacattaaccctcccaaacagtggtgggatgaaggggacacctctgcacctatt
agaactcctgcgatgattggttgctcctttgtggtgaatcgggagtactttgggcacctg
ggccttctagactctggcatggatgtctacggaggagagaacatcgaactggggatcaaa
gtctggctgtgtgggggcagtatggaggtgctgccatgctccagagtggcacacattgcc
agaatgaagaagccctaccacagcaacatagcctccagcacacgccgtaatgccctgcgt
gtggctgaggtctggatggaccagtacaagtcccatgtctacctggcctggaacatccca
atggagaaccatgggatagactacggggacatctctcagagagtagcgctgaggaagtct
ctgcaatgtaagaactttgagtggtacctggacaatgtctatccagagatgagaaggtac
aacaacacactcttttacggggagatccgtaatagtaaggccacacatctgtgtatggac
cagggagagaaggtgaaccacactgccaccctgcacccctgtcatggaatgggtcctcag
ttgggtcggtacaccaaggggggacagtttttcctaggtgctctaggcagtaccggggaa
gaaacgcgttgcctgatggacgaccagttctccaatttccctcagctcctcaactgtgac
aaagtttcaaacaccaggcttactctgtggcacttctctcagaatgactcaatcataaac
agagccacgggccgctgtctggaggtgatacaggccaacgtttacttcggacacgccttg
gtgctccaaacctgctccggacagaggtggaacatcaaaaacacagtgaagcagtag

DBGET integrated database retrieval system