KEGG   Esox lucius (northern pike): 105029077
Entry
105029077         CDS       T04894                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
els  Esox lucius (northern pike)
Pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105029077
   04068 FoxO signaling pathway
    105029077
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105029077
   04115 p53 signaling pathway
    105029077
   04218 Cellular senescence
    105029077
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105029077
NCBI-ProteinID: XP_010900527
UniProt: A0A3P8YHF5
LinkDB
AA seq 177 aa
MTSSPSTEAVMLVSGSVEELTRRARGPVRRNLFGPLDHEQLQQDFHRLLCKSVESATKRW
DFDFTADRPTQGSTVEWEEVKCQDVPLFYRSCVARKPVLSIAEGRAEREKIMPVWPASPG
SSSSGEEYLEVTTRESYRIQRPEKKTARQRSGAVKRRQAAITEFFAVKKMRAMKKKR
NT seq 534 nt   +upstreamnt  +downstreamnt
atgacatcatcaccatcaactgaggcggtcatgctagtatctgggagtgtggaagagctc
acgagaagagcccggggcccggtgaggaggaacctgtttgggcctttggaccatgagcag
ctgcaacaagacttccataggctcctgtgtaagagcgtggagtcagccaccaagcgatgg
gacttcgatttcaccgccgaccggcctacccaaggctctacagtggagtgggaggaggtg
aagtgccaggatgtgccattgttctaccgcagctgtgtggcgaggaagccagtgttgagc
atcgccgaagggagggccgagagggaaaagataatgccggtgtggccagcgtccccgggg
tcatccagctctggagaggaatatctggaggtgaccaccagggagagctataggattcag
aggccggagaagaaaacagccaggcagaggtcaggcgctgtcaaacggagacaggccgct
attacagaattctttgctgtgaagaagatgagagccatgaagaaaaaacgataa

DBGET integrated database retrieval system