KEGG   Esox lucius (northern pike): 105029082Help
Entry
105029082         CDS       T04894                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
els  Esox lucius (northern pike)
Pathway
els00590  Arachidonic acid metabolism
els01100  Metabolic pathways
els04370  VEGF signaling pathway
els04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105029082 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    105029082 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105029082 (ptgs2)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     105029082 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 105029082
NCBI-ProteinID: XP_010900535
LinkDB All DBs
AA seq 609 aa AA seqDB search
MNRSIATLLFLSLGILFVCEGGNPCCSQPCQNRGVCTAIDGNSYECDCTRTGFYGHNCTQ
PEFFTWIKMSLKPTPNTVHYLLTHYKGLWNIINSISFLRDSIMRYVLTSRSHMIDSPPTF
NADYDYKSWEAYSNLSYYTRTLPPLPKDCPTPMGVVGKKELPEAKVLAEKLLLRRMFIPD
PQGTSLMFAFFAQHFTHQFFKSDQKMGPAFTKAKGHGVDLGHIYGENLEKQHKLRLFKDG
KLKFQVLEGEVYPPTVEQVGVDMHYPPHVPESQRFAVGHEAFGLVPGLMMYATIWLREHN
RVCDVLKEVHPDWDDDRLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFKER
FQYQNRISSEFNTLYHWHPLMPDAFHIQEQVYSYPQFVFNTSVVTTHGIANLVESFTKQI
AGRVAGGRNVPAAVLMVALKSIENSRLMRYQSLNAYRKRFSMKPYTSFEELTGEKEMAAV
LEEMYGHVDAVELYPGLLVEKPRTNGIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTF
GGSVGFNIVNTASLQRLVCNNVKGPCPVASFHVRSVKDSGSNTINSSTAHSGNNDVNPTV
LLNERSTEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaagcatagcaacgcttttatttttgtctctgggcatactatttgtctgcgaa
ggaggcaacccttgctgctctcagccatgccaaaaccgtggcgtgtgtacggctatagac
ggcaacagctacgagtgcgactgtacacgtactggattctatggtcacaactgcacacaa
ccggaattctttacgtggattaaaatgtctctaaagccgacccccaacacagtgcattac
ctcctcacgcactacaagggcctctggaacatcattaacagcatttcattcctcagggac
agtatcatgagatatgttctgacatctcgctcccatatgatagacagccctccaaccttc
aatgcagactatgattataaaagctgggaagcttattccaacctctcctactacacacgc
accctccctcctttgcctaaggactgtccaacccctatgggagtcgtaggtaagaaggag
ctgcctgaggcaaaagtgctggcagagaagctcctgctcagaaggatgtttatccccgac
cctcagggcaccagcctgatgtttgctttctttgcccaacacttcactcaccagtttttc
aaatctgaccagaagatgggtccagccttcactaaggccaagggccatggggtggacctt
ggtcacatttatggtgaaaaccttgagaagcaacataaactgcgactcttcaaggatggc
aaattgaaatttcaggtgttggaaggagaggtgtaccccccgacggtggagcaggttggt
gtggacatgcactatcctccccatgttccagaatctcaacgattcgctgtgggccatgag
gcctttggcctggttcctggtctcatgatgtatgctaccatctggctaagagaacataac
cgcgtttgtgatgtcttgaaggaggtccacccggactgggatgatgataggctctttcag
acatctcgcctcattcttattggtgaaacaatcaaaattgtgattgaggattatgtacag
cacctgagtggttaccacttcaagcttaagttcgacccggagcttctcttcaaagagcgt
ttccagtatcagaaccgcatttcctcagagtttaacaccctttaccactggcaccctctg
atgccagatgcattccacatccaggagcaggtctactcctaccctcagtttgtcttcaac
acctctgtagtcaccacacacggtatcgccaatctggtggaatcctttaccaagcagata
gctggacgggttgccggaggtcgtaatgtccctgctgctgtgctgatggtggctctgaaa
tccatagagaacagcagactgatgcgctaccagtcccttaatgcctacaggaaacgcttc
tccatgaaaccgtacacctcatttgaagaactcacaggggaaaaggagatggctgcagtg
ttggaggagatgtatggccatgtggatgctgtggagctctacccaggtttgctggtggag
aagcccagaaccaatggcatatttggggagaccatggtagagatgggtgcaccctactcc
cttaaaggcctgatgggaaatcctatttgctcaccagagtactggaagcccagcaccttt
ggtgggagtgttggctttaacattgtcaacactgcatccctacagaggctggtatgcaac
aacgtcaagggtccctgccctgtagcatcctttcatgtgcgcagtgtaaaggacagtggc
tctaataccatcaattccagtacggcacattctgggaataatgatgtcaaccccactgta
cttctgaatgaaagaagcactgagctctga

DBGET integrated database retrieval system