KEGG   Esox lucius (northern pike): 105029585Help
Entry
105029585         CDS       T04894                                 

Gene name
kmt5b
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
els  Esox lucius (northern pike)
Pathway
els00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105029585 (kmt5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105029585 (kmt5b)
Enzymes [BR:els01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105029585 (kmt5b)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105029585 (kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 105029585
NCBI-ProteinID: XP_010901318
LinkDB All DBs
AA seq 965 aa AA seqDB search
MKWLGESKNMVLNGSRRHSSKYSSSEQQLVGQSQTRSQQHPQRSSLRSATGSRRCSRRFS
AASLEAERRYVPSSGMTAKELCEHDDLTTCLILDPYLGFQTHKMNTRFRPIKGRQEELKE
IIERFKKHDNLEKAFRALTSGDWSRHHFLHKSKAQEKLFKQHVFVYLRMFATDSGFEILP
CNRYSSEQNGAKIVATKEWKRNDKIEYLVGCIAELSESEENMLLRHGENDFSVMYSTRKN
CAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEHC
ECYTCERRLTGAFKSKAGLPAEAPVINSKYGLRETDKRLNRLKKMELGEGSRSSDSHSVG
SHTDIDSQDTPKTHTSVRKRTSSSKFSKTRTQTRQSLPRALTSTSPSKQSHIDSNRVPKR
LRSKPAKSSLSKVRLRSRVCSTGRGSESKAAAGAASGPRGGETVAPGPGRLGLRESRTSS
LCKAGVSVKKEKDTEGPVQTALGQRGCLTRHAAKENNTPTACESIPNQPCTYRTRRSTRT
LVKAQEAAAGLAGVKLEPVGLEGHSAVLGGVVIKTEPADLEEYLGHGLGGLELAGRLNTK
RGAGTRRSRLTQLRPERTIKREDSAYGEPVTPVATAPVASSRKPGHRHADADTADCGTML
LGFPVSERHWDYHGVANGSKPLRRNRDKGREKGRRDKDKGCYRSRRAERRGRGDRSQGKG
KKKRRITRYDAQLILENSGGIPKLTLRRRRDSSSSKTNEPNEGEPIGTQQQASSTTTALP
PTGQPAGNSTSASSKISIKFSKDRSQDRERGSSCSSYHVSKLNNGFGSPGHHGTGSSTKL
KIQLKREDDSRRVTQTHPDNSSLNGEVVGGGLGGGGFSLEARNGGNHGVHRTQNIVVDDS
SSDEVEEEEEDDDEDDEDDYFDDEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQS
LRLNA
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggcgaatccaagaacatggtgttaaatggcagccggcgacactcgagc
aagtactcctctagtgagcagcagcttgtgggccagagccagacccgctctcagcagcac
ccgcagaggagctccctacggtcggccacgggcagcaggaggtgtagccgccggttcagt
gcggccagcctggaggctgagcgtcgctatgtcccgtcctccggcatgacggccaaggag
ctgtgtgaacacgatgatctcaccacctgcctgatcctcgacccctatttagggtttcag
acacacaagatgaacaccaggtttcggccaatcaaagggagacaagaggagctgaaggag
atcattgagcggttcaagaagcacgacaacctggagaaagcattcagagctctcacctct
ggagactggtccagacatcacttcctgcacaagtctaaagcacaagagaagcttttcaaa
cagcatgtttttgtttatctccggatgtttgctactgatagtgggtttgagattctcccg
tgcaatcgctactcttcagagcaaaacggagccaagattgtcgcaacgaaggaatggaaa
cgaaatgataagattgaatatctagtgggctgcattgccgagctttcagagagcgaggag
aacatgttgcttcgccatggggagaatgacttcagcgtcatgtactccacacgcaagaac
tgtgctcagctttggctgggaccagcagccttcattaaccacgattgtcggccgaactgc
aagtttgtgtcgacaggacgtgacacagcctgcgtcaaggtgctgagagacatcgaaccg
ggggaggagatctcatgttactatggcgatggattctttggggaaaacaatgaacattgt
gaatgctacacatgtgaacgacgcctcactggtgctttcaaatccaaagctgggctgccg
gcggaggctccggtgatcaacagcaagtacgggttacgggagacggacaagcgcctgaac
cggctgaagaagatggagctgggagagggcagccgcagctcggacagtcactcggtcggc
tcccacaccgacatagactctcaggacacaccaaaaacacacacatctgtaaggaaaagg
acttcctctagtaagttcagcaaaaccaggactcaaaccagacagtctcttcccagggct
ctcacctctacctcaccttctaaacaaagtcatatagacagtaacagggtaccaaagaga
ctaagatccaaacccgccaagtcttccctctccaaagttcggttgcggagtcgggtttgc
agcacgggcagagggtcggaatccaaggcggcggcgggggcggcgtccgggccccgagga
ggggagacggtggctcccgggccgggccgcctcggtctccgtgagtccagaacgtcctcg
ctgtgtaaggcgggcgtgtctgtgaagaaggagaaggatacggagggaccggtccaaact
gctctgggccagcgagggtgtttgacccgccacgcggccaaggagaacaacacgccgaca
gcctgcgagagcatcccaaaccagccttgcacttacagaactcgcaggtccaccaggacc
ctggtgaaggcccaggaagctgccgccggcttggccggagttaaactagagccggtgggc
ctggaaggccacagcgccgtcctcggtggggtagtgattaaaaccgagcccgctgacctg
gaggagtatctgggccacgggctggggggtctggagctggccgggcgtctgaacacgaaa
agaggagccggtaccaggcgcagtcggctcactcagctccgtcctgagcggacgataaaa
cgcgaggactctgcgtacggcgagcctgtcacgccggtggctacggccccggtggcgtcc
tcccgtaaacccggccaccgccacgccgacgccgacacggcggactgcggcacgatgctg
ctgggcttccccgtctcggagcggcactgggactaccacggcgtggccaatggcagcaag
cccctccggaggaaccgggacaagggacgggagaagggccgacgggacaaagacaagggg
tgctaccggagccgcagggcggagcggcgcggcaggggggaccgatcgcagggcaagggg
aagaagaagcgtcggattacgcgctacgacgcccagctgatcctggagaacagcggcgga
atcccaaagctgaccctccgccggcggagggacagcagcagcagcaagaccaacgagccc
aacgagggggagccgatcggcacacagcagcaggccagcagcaccacaaccgctctgccg
cccacgggccagcccgcgggcaactctacgtcggcctcctccaagattagcatcaagttc
agtaaggaccgctcgcaggaccgggagaggggcagctcgtgcagctcctaccacgtgtcc
aagctgaacaacgggttcggatcgcccgggcaccacggtaccggcagctccaccaagctg
aagatccagcttaagcgcgaggacgacagccggagggtcacccagacgcaccccgacaac
agctccttgaacggggaagtggtggggggcgggttgggcggtgggggcttcagcctggag
gcccggaacggtgggaaccacggagtgcaccggacacagaacatagtggttgatgattct
tcgtctgatgaggtagaagaggaggaggaggatgatgatgaggatgatgaggatgactac
tttgacgatgagtttgaagacgatttcattccgcttcccccggcaaaacggttgcgtctc
atcgtggggaaagactctatagacatcgatatctcctccaggaggagggaagaccagtct
ctgaggctcaatgcctga

DBGET integrated database retrieval system