KEGG   Esox lucius (northern pike): 105029840Help
Entry
105029840         CDS       T04894                                 

Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
els  Esox lucius (northern pike)
Pathway
els00052  Galactose metabolism
els00500  Starch and sucrose metabolism
els01100  Metabolic pathways
els04142  Lysosome
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105029840
   00500 Starch and sucrose metabolism
    105029840
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105029840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105029840
Enzymes [BR:els01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105029840
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105029840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 105029840
NCBI-ProteinID: XP_010901696
LinkDB All DBs
Position
Unknown
AA seq 981 aa AA seqDB search
MTRHVTGASAFQNCGVFFVKMVSYKRLSPEDVQFSNTAASEEPPEEVTEVKAPEESERPL
LPRRPSCSATTAIISLGFLLLMASGIWLLGTIFWLHAPSSSAPHMAPPPRPSPGVGKAIP
DPQACAGVPEAWRFDCYPERGVVVTRELCEARNCCFIPASSPPPVRNSVPWCFYSPTFPS
YSLVSLNQTEQGEVGTLVRTVKTYYPKDVLTLQLEVLYETDHRLRVRISDPSASRFEVPI
AVPNATEKASSPAYSVELSKDPFGLVVKRTSSGTVLLNTTVAPLFFCDQFLQLSSSLSSQ
YVYGLGEHRSSFLHDIHWNTLTMWARDAAPMELTNLYGAHPFYLTMEEGGRGMAHGFFLL
NSNAMDVVLQPGPAVTWRTIGGILDFYVFLGPDPASVIGQYLEVVGYPSMPVYWALGYHL
CRWGYGSSSATWDVVKNMRNYGIPQDVQWNDIDYMDHALDFTFDPANFSTLPDMVKDLHN
HGQRYVMILDPGISSVQQEGRYWPYDEGLKRGVFINHSDGKTLIGKVWPGQTAFPDFSDP
VTHEWWYDNLKRFHDQVPFDGLWIDMNEPSNFVDGSTVGCPDNELENPPYTPGVLGGLLR
AKTVCASALQKTSLHYNMHSLYGLLEAKASANALRRILGKRAFVISRSTFPSQGLYSGHW
LGDNRSHWKDMYTSIAGMLTFNLLGVPLVGADVCGFSEQSDEELCVRWTQLGAFYPFSRN
HNTLGEPAQDPTAFSPLARAAMRQSLLLRYSLFPLLYTLFHRAHTHGHTVARPLLFEFPE
DVRTYGIDKQFLWGRSLLVTPVLDPGMDYVVGYFPQGLWYDYYTGDSVRSKGEELRLHAP
LDKINLYLREGAIIPTQRPNTTLWVSSGQPLHLISCLTEDGSATGELFWDDGESLDTFET
DQYAEIAFSVVKNTMTSEVLRDHVEASYMTVETASIYGVKSKPSRVTVNSHDAAFSYRDN
QVLTVTDLGLNLSQNFTISWM
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacatgtgacgggtgcttctgctttccaaaactgcggcgttttctttgtgaag
atggtgtcttacaagcggctgagtccggaggatgtccagttctccaacaccgctgcttca
gaggagcctcctgaggaagtgaccgaggtgaaggccccagaagaatcagagcgccctctg
ctgccacggaggccctcctgctctgccaccacagccatcatatccctgggcttcctgctc
ctgatggccagtggcatctggctgctgggaaccatcttctggctccatgccccctccagc
agtgctccccacatggccccgcctcccaggccttccccgggggtgggcaaggccatacct
gacccccaggcctgtgcgggggtcccagaagcctggaggtttgactgctaccccgagaga
ggggtcgtggtgacgcgggagctgtgcgaggcaaggaactgctgcttcatccctgcctcc
tctcctcccccggtgaggaacagtgtgccgtggtgtttctactcaccgacattcccctcc
tactccctggtgtcgcttaaccagacggagcagggtgaggtgggcaccctggtgaggacg
gtgaagacctactaccccaaagatgttctgaccctgcagctggaggtcctctacgagacg
gaccacaggctaagagtcaggatcagcgacccgtccgcatcgcggtttgaggtgcccatt
gctgtgcccaatgccacggagaaggcctctagtcccgcctactctgtggagctgtccaaa
gacccgttcggtctcgttgtgaagagaacgtcctcggggactgtgctgctcaacacaact
gtagctcccctgttcttctgtgaccagttccttcagctgtccagcagtctgtccagccag
tatgtgtacggcctgggggaacaccgctcttccttcctccacgacatccactggaacaca
ttgaccatgtgggcaagagacgcggcgcccatggagctcactaacctgtatggggcccat
ccattctatctgaccatggaggagggaggccgtggaatggcacacggattcttcctgctc
aacagcaacgctatggatgtggttctccagccaggacctgctgtcacctggcgtaccatc
ggtgggatcttggacttctacgtcttcctgggtcctgacccggcctccgtgattggacag
tacctggaggttgtaggctacccctccatgcctgtctattgggcgctaggttaccatctc
tgtcgctggggttatggatcaagcagcgccacctgggatgtcgtgaagaacatgaggaat
tatgggattcctcaggacgtccagtggaatgacattgactacatggaccatgccctggac
ttcacctttgaccctgctaacttctccaccctgcctgacatggtgaaggacctccacaac
catggacagcgctacgtcatgatcctggaccccggaatcagcagcgtccagcaagaggga
cggtactggccgtatgacgaaggcctgaagagaggagtcttcatcaaccacagcgatgga
aagactctcattgggaaggtttggccgggtcagacagcttttccagatttttctgatccg
gtgacccatgagtggtggtacgacaacctgaagaggttccatgaccaagtccccttcgac
ggcctgtggattgacatgaacgagccatctaacttcgtggatggctcgacagtaggttgt
cctgacaacgagctagagaaccccccttacacacctggtgttttggggggattgttgagg
gccaagacagtgtgtgcctcggcgctccagaagacctcgttacactacaacatgcacagt
ctctatgggctactggaagccaaggcctctgccaatgctctgaggcgtatcctggggaag
agggcgtttgtgatctcccgctccaccttccccagtcagggcctctactctggtcactgg
ctgggagacaaccggagtcactggaaggacatgtacacctccatagcaggtatgttgacc
tttaacctcctgggtgtccccctggtcggggctgatgtatgtggattcagcgagcagagc
gacgaggagctgtgtgttcgctggacacagctgggcgccttctaccctttctcacgcaac
cacaacaccctgggcgagccggcccaggacccgacggcgttcagccccctggcccgcgcc
gccatgagacagtccctgctgctccgctactccttgttccctctcctgtacacgctcttc
caccgtgcgcacacacacggacacactgtcgcacggcctctgctgttcgagttccctgaa
gacgttaggacgtatggtattgacaaacagttcctgtgggggaggagtttgttggtgaca
ccagtgttggatccagggatggactatgtggtgggctacttcccccaggggctttggtac
gactactacacgggagattctgtccggagtaaaggagaagagttgcgtcttcatgctcct
ctggacaagatcaatctctacctgagagaaggagccatcatacctacacaacgtcccaac
accaccctgtgggtgagcagtggtcagcctctccacctgatttcctgtctgactgaagac
ggctcagccacaggagaactgttctgggacgacggagagagccttgacacttttgagacc
gaccagtacgctgagatcgcattcagtgtggttaagaacaccatgacatcagaggtgctg
cgtgaccacgtggaggcgtcttacatgaccgtggaaacggcctcaatctacggcgtgaag
tcaaagcccagccgggtcactgtgaactcccacgatgcagcgtttagctacagagacaat
caggtattgacagtaacagacctaggattgaacctcagccagaacttcaccatcagttgg
atgtaa

DBGET integrated database retrieval system