KEGG   Esox lucius (northern pike): 105029895
Entry
105029895         CDS       T04894                                 

Definition
(RefSeq) erythropoietin isoform X2
  KO
K05437  erythropoietin
Organism
els  Esox lucius (northern pike)
Pathway
els04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105029895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:els04052]
    105029895
Cytokines and growth factors [BR:els04052]
 Cytokines
  CSF and other factors
   105029895
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 105029895
NCBI-ProteinID: XP_010901757
UniProt: A0A3P8Z950
LinkDB
AA seq 204 aa
MGNRRAKGRNGEDPVRDYVDSDMEAPRLLTLLLMLLEWTRPGRASPLRPICDLRVLKHFI
EEAKDAEAAMLTCKEGCGLPEPVTVPQTKVDFNVWERKNAPEQAKEVQSGLWLLSQAVGS
LRGSVTDATLHSHIDNSLRNIFSIGQVLRSLNFQEYPPPGVGVSGAETWRVSSASELLQV
HVNFLRGKVHLLLSNAAVCQQGGS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcaatagacgggccaaggggagaaacggcgaggatcctgtgagggattatgtggat
tccgatatggaggcacccagactcttaaccttgctgctgatgctgttggagtggacaaga
ccaggccgagcttcccccctgcgacctatctgcgacctgcgggtcctaaaacacttcatt
gaggaggccaaagacgctgaggcagccatgctgacatgtaaagaaggatgtgggctccca
gagcccgtcactgttccccaaaccaaagtagacttcaatgtctgggagaggaaaaatgca
ccggagcaagctaaggaggtgcagtcgggtctgtggctgttgagccaggccgtgggctcc
ctacgaggctccgtcaccgacgcgacgctgcacagccacatagacaacagcctccgaaac
atcttcagcatcggacaggtgctgcgcagcctcaacttccaggagtacccccctccagga
gtgggagtgtctggagcagagacatggagggtgtcgtctgcgtcggagctcctccaggtc
catgtcaacttcctgcgaggaaaggtgcacctgttgctgtccaacgcagccgtctgccaa
cagggtggaagctga

DBGET integrated database retrieval system