KEGG   Esox lucius (northern pike): 105030446Help
Entry
105030446         CDS       T04894                                 

Definition
(RefSeq) alpha-amylase 1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
els  Esox lucius (northern pike)
Pathway
els00500  Starch and sucrose metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105030446
Enzymes [BR:els01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105030446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 105030446
NCBI-ProteinID: XP_010902621
LinkDB All DBs
AA seq 506 aa AA seqDB search
MMKYIVVLAVLCLGLSWAYNNPHTKHGRQTIVHLFEWKWTDIAAECERFLAPKGYAGVQI
SPPQESIVLTNPWRPWWERYQPISYNLCSRSGNENDLKDMITRCNNVGVNIYVDAVINHM
CGSGAGEGTHSNCGTYFNANKREFPSIPYGAFDFNNAKCKTSSGNIENYNDINQVRDCKL
VSLLDLALEKDYVRGKVADYMNKLIDMGVAGFRVDACKHMWPGDMEAVFGRLHNLNAKWF
DKNSRPFIFQEVIDMGFEAIKASEYFHLGRVTEFKYSVKLGTIMRKWDNEKLCYTKNWGE
GWGFMPSHNALVFVDNHDNQRGHGAGGPSIVTHKDSRLYKMATAFMLAHPYGMARVMSSF
GWQHTDQGPPSHLNGNTKDVPINVDGTCGDGWVCEHRWRQIMNMAAFRNVVNGQPHSNWW
DNGSNQVAFGRGNRGFIVFNNDNWQLDVTLNTGMPGGIYCDVISGQKQGEVCTGKAIHVK
LDGHAHFVISNTDEDPMVAIHAESKL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagtacattgttgtgttggccgtcctgtgtctgggtctgagttgggcttacaac
aatccacacacaaagcacggcagacagaccatcgtccacttgttcgagtggaagtggact
gacatcgcagccgagtgtgagaggttcctcgctcccaaaggatatgctggggttcagatc
tctcctccccaggagagcattgttttgaccaacccctggaggccctggtgggagaggtat
cagccaatcagctacaacctgtgttccagatcaggaaatgagaatgacctcaaagacatg
atcaccagatgcaacaatgttggggtcaacatctacgtcgacgctgtcatcaaccacatg
tgtggatccggagctggcgagggaacccattccaactgtggaacctacttcaatgctaac
aagagggagtttccctccattccgtatggtgcctttgactttaacaatgccaagtgcaaa
accagcagcggcaacattgagaactacaatgatatcaatcaggtgcgcgactgtaaactg
gtgagtctactggaccttgccctggaaaaggactacgttaggggcaaggttgcggactac
atgaacaagctgatcgacatgggggtggctgggttcagagttgacgcctgcaagcacatg
tggcccggcgacatggaggctgtgtttggacgtctccacaacctcaacgctaaatggttc
gacaagaactccaggccctttatattccaggaggttattgatatgggatttgaagccatc
aaggcctcagagtacttccacctgggcagagtgactgagttcaagtattcagtcaaactg
ggaaccatcatgaggaagtgggacaatgaaaagctgtgttacacaaagaactggggtgag
ggttggggcttcatgcctagccacaatgctctggtgtttgtggataaccatgataaccag
agaggccatggagcaggaggaccatccattgtcacccacaaggactccaggctttacaag
atggccactgccttcatgctagcccatccctatggaatggcccgggtcatgtcctccttt
ggctggcaacataccgatcagggccctcccagccacttgaacgggaacaccaaggacgtt
cccatcaacgttgacggcacctgtggtgacggttgggtgtgtgagcaccggtggcgccag
atcatgaacatggctgccttccgtaacgtggtgaatggacagccccattccaactggtgg
gataatggcagcaaccaggtagccttcggacgcgggaaccgtggcttcattgtctttaac
aatgacaactggcaactggatgtgactctgaatactggaatgcctggtggcatctactgt
gatgtcatttctggccagaagcaaggagaggtctgcactgggaaggccatccatgtcaag
ttggatggccacgcccacttcgtgatcagcaacaccgatgaggatcccatggtggcaatc
catgctgagtccaagctgtaa

DBGET integrated database retrieval system