KEGG   Esox lucius (northern pike): 105030753
Entry
105030753         CDS       T04894                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04210  Apoptosis
els04620  Toll-like receptor signaling pathway
els04621  NOD-like receptor signaling pathway
els04622  RIG-I-like receptor signaling pathway
els04623  Cytosolic DNA-sensing pathway
els04625  C-type lectin receptor signaling pathway
els04920  Adipocytokine signaling pathway
els05132  Salmonella infection
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105030753 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105030753 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105030753 (ikbkg)
   04621 NOD-like receptor signaling pathway
    105030753 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    105030753 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    105030753 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    105030753 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105030753 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105030753 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105030753 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105030753 (ikbkg)
Protein kinases [BR:els01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   105030753 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 105030753
NCBI-ProteinID: XP_010903123
UniProt: A0A3P8YWZ7
LinkDB
AA seq 601 aa
MVQPQADITLHWEVAGGEGGGALRVPPELASNEVVTRLLGDNQQLREALRCSNQALRERC
EEMEEWQRRSREEREFLSCRFQEARALVERLARENHSLSSLINPPNSGSNPGADPGLLVN
GPSSSPANCSSNGPPAGERSGGDQGRKSSETNGPIASPLTAEKRGMERGGENEQMMLSSL
PTEGGNQVLLLLKGHREQLEEGMRDLRRRNEELEKERETGERERDELRRSVEELRIKLVQ
AQSGVITVETPQRSDAPPQSDSSHLAKLTEQLQATQGRHRELQEKLDSLQKRSAQTDRAE
VMLKQKDKDCNQLAKDAEALKAQVTSLLGELRERQSCLERSQEDRSIQEKKLNSALEALA
ACERELEQQKTQHSVTVDKLLLQKQNLETALKTDRLVITEERRKLAQLQHAYTCLFRDYD
SKLKNEDGDVCGRLEEAERALALKQDLIDKLKEEVEQQRGSLETVPVLTAQAEIYKADFL
AEREAREKLNQRKEELQDQLNTAHAEIERLKQEGTSRARMEEMQQRHLGPHIPPQPGAFP
GGAFNTAPPPSSFRSVGLAGGVVVGVPGGGAEELPDYRCPKCQYQAPDMDTLQIHVMDCI
Q
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggtgcagccccaggcagacattaccctgcactgggaggtggctgggggcgaggggggc
ggggctcttcgagttccacctgaactggcatccaatgaggtggttacaagactgctgggt
gacaaccaacagctcagagaggcgttgcggtgcagtaatcaggcactccgtgagcgctgt
gaagagatggaggaatggcagaggaggtccagggaggagagggagttcctcagctgtcgt
ttccaggaggcccgggcgctggtggagagactggccagagaaaatcacagcctctccagt
ctgatcaacccccccaactctggatccaaccctggagctgatcccggcctgctggtcaac
gggcccagctccagtccagccaactgcagctccaacgggcctcctgctggggagagaagt
gggggagaccaggggaggaagagctcagagaccaacggaccgatagcatcccctctgaca
gctgaaaagagagggatggagagaggaggggaaaatgaacagatgatgctcagcagcttg
cctacagagggtgggaaccaggttcttctgctgctgaaaggccacagagagcaattggaa
gaagggatgagagatcttcggaggaggaatgaagaattggagaaggaaagggagacagga
gagagggagcgagacgagcttcgtcgctctgttgaagaactcagaatcaaactggttcag
gcacagagtggtgtcatcacagtggaaacacctcagcgttctgatgcccccccacaatct
gacagctcccaccttgccaaactcacagaacagctgcaagccacacagggcagacacaga
gagttgcaggagaagttagattccctccagaagaggtctgctcagacagaccgggctgaa
gtaatgctgaaacagaaggataaagactgtaaccagctggctaaggatgctgaggccctg
aaagcccaggtgacatctctcctgggagaactgagagagaggcagagttgtcttgaacgg
agtcaggaagaccgcagcatccaggaaaaaaagctgaacagtgctctggaggcattagca
gcatgtgagagggagttggaacaacagaagacacagcattctgtcactgtggataaactc
ctgctgcagaaacagaacttagagaccgccctcaagactgaccgactggtcatcacagag
gagaggaggaagttagcccagctgcagcatgcatacacctgtctgttcagagactatgac
tccaaactcaagaatgaggatggagatgtgtgtgggcgtctggaggaagcagagagggct
ttggctctgaaacaggatctgattgacaagctgaaggaggaggtggagcaacagagagga
tccctggagactgtccctgttttgaccgcacaggctgagatctacaaggctgacttcctg
gcggaacgagaggccagagagaaactcaaccagaggaaagaggagctccaagaccagctg
aacacggcccacgctgagatagaacgcctcaaacaggaaggaacctcacgggctcgtatg
gaggagatgcagcaaagacacttgggaccccacatccctccacagccaggtgcgttccct
gggggtgcgttcaacacagcccctcccccttcctctttccgtagtgtggggttggctggc
ggagtggtggtgggtgtacctggaggcggggctgaggagcttccagactaccgctgtcca
aagtgccagtaccaagccccagacatggacaccctgcagatacacgtcatggactgcatc
cagtaa

DBGET integrated database retrieval system