KEGG   Esox lucius (northern pike): 105030774Help
Entry
105030774         CDS       T04894                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
els  Esox lucius (northern pike)
Pathway
els00040  Pentose and glucuronate interconversions
els00051  Fructose and mannose metabolism
els01100  Metabolic pathways
Module
els_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105030774 (sord)
   00051 Fructose and mannose metabolism
    105030774 (sord)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105030774 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 105030774
NCBI-ProteinID: XP_010903158
LinkDB All DBs
AA seq 354 aa AA seqDB search
MEKDNLSVVLHSQGDLRLEQRPIPEPGPNEVLIQMHSVGICGSDVHYWQRGRIGDFVVKK
PMVLGHEAAGRVVKVGSEVKHLKEGDRVAVEPGVPREMDEFFKSGNYNLSPTIFFCATPP
DDGNLCRYYKHSANFCYKLPDNVTYEEGALIEPLSVGIHACRRAGVTLGSSILICGAGPI
GLVCLLVGQAMGASQVVMTDLSPDRLAMGKELGADHCLTVKREDGPEELARRVEGLLGAQ
PHVTIECTGVESSVQTAIYSTRPGGVVVLVGLGAPMTTVPLLSAAVREVDIRGVFRYRNT
WPMAIAMLASKKVNVAPLVTHRFPLEQAVQAFETTRQGLGVKVMLKCDKTDQNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggacaacctatccgtggttttgcattcccagggcgacctcagactggaacaa
cgccctattcctgaaccaggtccaaatgaggtattgattcagatgcactctgttgggatc
tgtgggtcggatgtgcactactggcagcgtggacgcataggcgacttcgtggtgaagaag
cccatggtgctagggcatgaggccgctggaagggtggtgaaggtaggctcagaagtgaag
cacctcaaagaaggggatagagttgctgtagagccaggtgttcctcgcgagatggacgag
ttcttcaaatcaggaaactacaatctgtcccccaccatattcttctgtgccaccccacct
gatgatgggaatttatgcagatattacaaacacagcgccaacttctgttacaagttacct
gacaacgtgacatatgaggagggggccctgattgagcccctgtctgtgggcatccatgcc
tgtcgaagagctggagtgacccttggcagcagtatcttaatctgcggggcaggacccatt
gggttggtctgtttgctggtgggtcaggctatgggtgcttcacaggtggtcatgaccgac
ctgtcgccagatcgcctggccatgggcaaggagctgggagcagaccactgtctgactgtg
aagagggaagacgggcctgaggagctggccaggcgggtggaggggctgctgggagcgcag
cctcatgtcaccatcgagtgcaccggcgtggagagcagtgtccaaacggccatttattcc
acgcgtcccggaggagtggtggttctagtgggtcttggcgccccgatgaccacggtccca
ctgctcagtgctgctgtcagagaggtggacatcagaggagtcttccgctaccgcaacacc
tggccgatggctatagcgatgctggcctcaaagaaggtgaatgtggctcctctggtgact
catcggttccccctggagcaggcggtgcaggccttcgagaccacgcgacagggactgggt
gtcaaggtcatgctgaagtgtgacaagactgaccagaacccctga

DBGET integrated database retrieval system