KEGG   Esox lucius (northern pike): 105031261Help
Entry
105031261         CDS       T04894                                 

Definition
(RefSeq) coagulation factor XIII A chain-like isoform X1
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
els  Esox lucius (northern pike)
Brite
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105031261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 105031261
NCBI-ProteinID: XP_010903889
LinkDB All DBs
AA seq 732 aa AA seqDB search
MSDNEPATKPPPKVFHRGRTATPVANSNADKKEVPEFEPFGLMPRGPPPLIEFLDIWEVD
MLQTQSGVNKPQHNTHVYANDRLIVRRGQEFQLKVTFDRAYKPSEDQFAVEFVIGASPQF
NKGTYIPVFVNKERQSPWPGRVVDSTDNVVTLGITPAPDCIVGKWRVYLAVMTPYGIRRT
KWDETRDVYILFNPWAPADSVFLDDYNERLECVLNELGVIYHGAFDDVAERPWNFGQFDY
GVLDACLFILDKASMPITNRGDPIKVTRIASAMLNSRDDDGVLEGNWGGDYTYGVAPTSW
TGSSEILLQYSSSKRPVCYAQCWVYAAVFNTFLRCLGIPGRVVTNFFSAHDNNGNLRTDI
ILDDNGKIDRLRTVDTIWNYHCWNECYMTRPDLPPGFGGWQVVDATPQETSDGMYRCGPA
SVHAIKHGQLCYQFDAPFVFAEVNSDVVFKSRNRDGTLSTVKVNTSHVGRMVLTKAQGQD
TRRDITDHYKFSEGSPEERTVLEKAEEYGSEREKASPPKGDVELVMPLVEVRVGDSFELK
LVLDNASDQARSVDMYVSGNVVYYTGVTSSEFLFKSPEMTLGPKKAGKEVVIPVPSKDYM
RQLVEQANLHFIATGKVKETGQIISAMRVVTLHTPKLSVEVSGQAKVGEKMLAIIKFTNP
FKFNLEDVNVRVEGPGVMSPKHKHYSLVTPGSSLTWTEHFHPRRAGPTKLMASLDCAALR
QVYGQVELAVEP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaacgagcccgccaccaagccgcccccgaaggtgtttcaccgcggccgcacc
gccacccccgttgccaactccaacgcggataagaaggaggtgcccgaatttgaaccgttt
ggcttgatgccccggggaccccctccgctcatcgagtttttggatatttgggaggtggac
atgcttcagacccagagcggtgtcaacaagcctcagcacaacactcacgtatacgcaaac
gacagactcattgttcgcaggggacaggagttccagctcaaggtgacatttgaccgtgcc
tacaaaccctctgaagaccagtttgccgtggagtttgtcattggggccagtccccagttc
aacaaggggacctacatccctgtgttcgtgaacaaggagcgtcagagcccatggccaggt
cgagtggtggacagcactgacaacgtggtcacactgggcatcacccccgcgccggactgc
attgtaggaaagtggcgcgtttacctggcagttatgacaccctatggaattcgcaggacc
aagtgggacgagaccagggatgtctatattcttttcaacccttgggcaccagcggattca
gtgtttctggatgattataatgagaggctggaatgtgttctgaatgagctgggggtcatc
taccacggtgcgtttgatgacgttgctgagcggccttggaactttggtcagtttgactac
ggggtgctggatgcctgtctgttcatcttggataaagctagcatgcccatcaccaacagg
ggcgatcccatcaaagtaactcgtattgcctcagccatgctgaactctcgtgacgacgac
ggggtcctggagggtaactggggcggggactacacctacggagtggctcccacttcctgg
acaggaagcagcgagatcctcctccagtactccagcagcaagcgacctgtctgctacgcc
cagtgctgggtctacgctgccgtcttcaacacctttctgcgctgtcttggcatcccagga
agggtggtcaccaacttcttctcagcccatgacaacaatggcaacctgagaacagacatc
atccttgatgacaatggcaaaattgacaggctgcgcactgtggacaccatttggaactac
cactgctggaatgagtgttacatgaccaggccggaccttccgccagggtttgggggctgg
caggtggtggatgctacaccccaggagacaagcgatgggatgtaccgttgtggccctgcc
tccgtccacgccatcaaacacggccaactctgctaccagtttgacgcaccctttgtgttt
gctgaggtgaacagtgatgtggtgttcaaatcccggaacagagacgggaccctgtccacg
gtcaaggtcaataccagccatgttggaaggatggtgttgaccaaagctcaaggccaggac
actcgccgtgatatcactgaccattacaagttctcagagggcagtccggaggagcgcacg
gtgttggagaaagcggaggagtatggcagcgagcgtgagaaagcctcccctcccaagggg
gatgtggagctggtaatgcccttggtggaggtgagggtgggggacagcttcgagctgaag
ctggtgttggacaacgcgagtgaccaggctcgctccgtggacatgtacgtcagtggcaac
gtggtgtattacacaggagtcaccagctccgagttcctgttcaagagccccgagatgacc
ctgggtcccaagaaagctgggaaggaggtggttattccggtgccttccaaggactacatg
agacagctggtggagcaggccaacctccacttcattgccactgggaaggtcaaggagacc
ggacaaatcatcagcgctatgagggttgtcaccttgcacaccccaaaactctctgtggag
gtgtctggtcaagctaaagtgggcgagaagatgttagcgatcataaagttcaccaaccca
ttcaagttcaacctggaggatgtgaacgtgcgcgtcgagggaccaggggtcatgtcaccc
aaacacaagcactacagcctggtcacgcctggctcgtcactgacgtggacagaacacttc
cacccccgtcgggcgggacccaccaagctgatggccagcctggactgtgctgccctcaga
caggtgtatgggcaggtcgagctcgccgtcgaaccctga

DBGET integrated database retrieval system