KEGG   Esox lucius (northern pike): 109615805
Entry
109615805         CDS       T04894                                 

Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
els  Esox lucius (northern pike)
Pathway
els00220  Arginine biosynthesis
els00330  Arginine and proline metabolism
els01100  Metabolic pathways
els04020  Calcium signaling pathway
els04146  Peroxisome
els04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109615805
   00330 Arginine and proline metabolism
    109615805
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109615805
   04020 Calcium signaling pathway
    109615805
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109615805
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109615805
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 109615805
NCBI-ProteinID: XP_019902072
LinkDB
AA seq 1136 aa
MQTGFSINIRSKNIKRKQETVWFVTEVPCGMGLHQMVQHSATSPRKMKTRVMEMEVLQDD
ETKITCQTELKRWETRVDRCVFSIPVRNVKDGSSLHDTLHHQAVKSLPCTSKVCESSHIT
PKALVCFAKDASLEILPQAIDLINQYYNSLKIPKIKQHHARLEEIAMEINTTGTYQLTSE
ELVFGAQHAWRNAPRCIGRIQWSNLQVFDARKCRTTQDMFQYLCEHLQFATNGGNLRSAI
TVFPQRVDDRHDFRVWNSQLVKYAGYQMPDGSIQGDPSSVEFTEICIQLGWRPRYGLFDV
LPLVLQANGEDPDIYEIPPDLILEVRMEHPQYKWFQDLGLKWYAVPAVSNMLMEIGGLQF
PAAPFNGWYMGTEIGVRDFCDYQRYNILEEVGRRMGLETNKLSSLWKDQALVAINVAVIY
SFQKNKVTITDHHSVAESFIKHMETEFRLRGGCPADWVWLVPPMSGALSPIFHQEMVNYI
LSPFFFYQPDPWTTHVWTNGKKTSSNKQISFKSLARAVLFSSTLMSRVLAKRVRCTVIYA
TETGKSQTLAQRLNSMLNSAFNSRLLCMEDYNLSDMEQESLLVVVTSTFGNGDSPQNGES
FRKQLFSLCYLRNKIRYCVFGLGSRMYPQFCAFAHAVDDKLEKLGAKRLTPTGEGDELHG
QEEAFSVWALNVLKSAYKEFNFQGHVSLQLPEAERLNEVKDSMTYRMALERCSQDHIRAL
SAVHSKTVFPMKLKRRQNLQSHCSSLSTILVELEKEKSEDVLEFAPGDHVAVFPGNLPEL
VDGILKFLPHPPQISQCLRLEYCSDSFLEGEKNWQIVKHTPERHLSQALTYFLDVTTPPS
QNLLHKLSQLTKQEEHCQRLLTLAKNSQEYTKWKTFCVPNFLEVLEEFPSLEPSSEFLLS
QLPVLKPRLYSISSSPQLHPNELHLTVTVLNYHTQEGQGPLHHGVCSTWLNTINEGDLVP
CFINSSNGFHLPAEPSTPVILVGAGSGIAPFRSFWQQRLYDMKQTGFSGGPMSLVFGCKS
SETDELYKEETLEMIRKGVLKSVTSTYSCQPGYPKLYVQDFLRDSMAEEVLSVLCQKEGH
LYVCGGVNMAQGVTLAVQEILSSQLGITLTQAGEYLAKLKIQRRYHEDIFGARCHK
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgcagactggattctcaataaatataagaagtaagaatataaagagaaaacaagagact
gtttggttcgttacagaggttccctgtggaatgggccttcatcaaatggtccagcattct
gctacttctcccaggaaaatgaagactagagttatggagatggaggtgcttcaagatgat
gaaaccaaaataacttgccagactgaacttaagaggtgggaaactagagttgacagatgt
gtgttttcgatacctgtgcgtaatgtaaaggatggatcaagtcttcatgacaccctgcac
caccaagcagtcaagagtctaccatgtacatcaaaagtttgtgaaagttctcatataaca
cccaaggctcttgtgtgctttgccaaagatgcctctcttgagattctaccccaggcaatc
gacttaattaaccagtactacaactccctcaaaatccccaaaattaaacagcaccatgcc
agattggaagaaattgcaatggagattaataccacaggaacatatcaactcacttcagag
gaattagtgtttggtgctcagcatgcatggaggaatgccccaagatgcattggcaggatt
cagtggtccaacttacaggtatttgatgccagaaaatgcaggacaactcaggacatgttc
cagtatctgtgtgaacatttacagtttgccacaaatggaggaaatttaaggtctgcgatt
acagtattccctcagagagtggatgaccggcatgatttccgggtgtggaacagccagttg
gttaagtatgcaggttaccagatgcctgatggcagtatccagggagacccatccagtgtg
gaattcactgagatctgtatccagcttggatggagaccccgctatgggctttttgatgtg
ttgccactggtcctgcaggccaatggggaggatccggatatttatgaaatccctcctgac
ctgatcctggaggttcgcatggaacaccctcaatataagtggttccaagacctaggactg
aagtggtatgctgtgccagcggtgtccaacatgctgatggagattggcggacttcaattc
cctgccgctccatttaatggctggtacatgggtacagagattggtgtcagggatttctgt
gactatcagcgttataacatcttggaggaagtgggtcgtaggatgggcctggagacaaac
aagctgtcctcactttggaaggaccaggccctggtggccatcaatgttgcagtcatatac
agtttccagaagaataaggtgacaatcacagaccaccactctgtagcagagtccttcatc
aaacacatggaaacagagttccggctgcgtggcggctgccctgcagactgggtctggctg
gttccacccatgtcgggcgctctctcccccatcttccaccaggagatggtcaactacatc
ctatcacccttctttttctaccagcctgatccttggactactcatgtctggactaatggg
aagaaaacctcaagcaacaaacagatcagtttcaaatcacttgccagggctgtgctcttc
tcttcaactctcatgagcagagtgctggctaaaagggtgcgctgcactgtcatttatgcc
actgaaacaggcaaatcacagactttggcccaaagactgaactccatgctgaactctgcc
ttcaactccaggttgctttgcatggaggactacaatctcagtgacatggaacaggagagc
ctcctggttgtggtcacaagcacctttgggaatggagactccccccaaaatggagagagt
ttcaggaagcagcttttctccttatgttatctcaggaacaagataaggtactgtgtgttt
gggctgggatctagaatgtacccacaattctgtgcatttgctcatgctgtggatgacaag
ctggagaagttgggggcaaagcggctgactcccactggagagggggatgaactgcatgga
caggaggaggccttctctgtctgggctctcaacgtgctaaagagtgcctataaagagttc
aacttccagggtcatgtgagtctgcagctccctgaggcagagaggttaaatgaggtcaag
gactctatgacgtaccgcatggcactggagagatgcagccaggaccacatcagagcactt
tcagctgttcactctaaaacggtctttccaatgaaactgaagaggagacagaatctacag
agccactgttcaagcttgtccaccattctggtggagctagagaaggagaaaagtgaagat
gtcttggaatttgctccaggagaccatgtggcagtttttccaggaaacctccctgaactg
gtggatggtatcctgaagttccttccccacccacctcaaatcagccagtgcctacgactg
gaatattgctcagactcatttctagagggtgagaaaaactggcaaattgtcaaacatacc
ccagaacggcatttgtctcaggcgctcacatacttcctggatgtgaccacgcccccctct
cagaaccttttacacaagctctctcagctgacaaaacaggaagaacattgccagcgtcta
ttgaccttggcaaagaactctcaggagtacacaaagtggaagacattctgtgttccaaat
tttctggaggtcctggaagagttcccttctttagaaccctcttcagaattcctactcagc
cagctgcccgtgctcaagccccgcctctactctatcagctcctcccctcagctccacccc
aatgagctacatctcactgtgacggtgctcaactatcacactcaagaaggacagggtcct
cttcaccatggggtgtgcagcacatggttgaataccattaatgaaggagacctggtccca
tgtttcatcaacagctcaaatggtttccaccttccagctgagcccagtactccagtcatt
ctagtgggggctggcagtggcattgcacccttccgaagcttctggcagcaacgcctatat
gacatgaaacaaacagggttttctggaggtcctatgagtcttgtttttggctgcaagagc
tcagagacagatgagttatacaaagaagaaacactggagatgatacgtaaaggtgtcttg
aagagtgttacgtccacatactcctgtcagccgggttacccaaagttatatgtccaggat
tttctgagggacagcatggcagaggaggtgctaagtgtgttgtgtcagaaggagggtcac
ctctatgtttgtgggggtgtgaacatggcccaaggagttactctagcagtacaagagatc
ctgagcagccaacttggcatcaccctcacccaggcaggagaatatctggccaaactcaag
attcagaggaggtaccacgaagacatttttggggcccggtgtcataagtaa

DBGET integrated database retrieval system