KEGG   Escherichia coli UM146: UM146_02590
Entry
UM146_02590       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
elu  Escherichia coli UM146
Pathway
elu00230  Purine metabolism
elu00240  Pyrimidine metabolism
elu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UM146_02590
   00240 Pyrimidine metabolism
    UM146_02590
Enzymes [BR:elu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     UM146_02590
    3.2.2.-  
     UM146_02590
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: ADN69939
LinkDB
Structure
PDB: 
6GFL 6GFM

Position
complement(560301..561665)
AA seq 454 aa
MITHISPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSGSLTDNSKELLSRFEN
FDINVLRRERGVKLELINPPEEAFVDGRIIRALQANLFAVLRDILFVYGQIHNTVRFPNL
NLDNSVHITNLVFSILRNARALHVGEAPNMVVCWGGHSINENEYLYARRVGNQLGLRELN
ICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAAEPPNPLVNELIIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPANKDQVLPLILTGPKESADYFRVLD
EFVVHTLGENARRHYRIIIDDAAEVARQMKKSMPLVKENRRDTGDAYSFNWSMRIAPDLQ
MPFEPSHENMANLKLYPDQPVEVLAADLRRAFSGIVAGNVKEVGIRAIEEFGPYKINGDK
EIMRRMDDLLQGFVAQHRMKLPGSAYIPCYEICT
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacacatattagcccgcttggctccatggatatgttgtcgcagctggaagtggat
atgcttaaacgcaccgccagcagcgacctctatcaactgtttcgcaactgttcacttgcc
gtactgaactccggtagtttgaccgataacagcaaagaattgctgtctcgttttgaaaat
ttcgatattaacgtcctgcgccgtgaacgcggcgtaaagctggaactgataaatcccccg
gaagaggcttttgtcgatgggcgaattattcgcgctttgcaggccaacttgttcgcggtt
ctgcgtgacattctcttcgtttatgggcaaattcataacaccgttcgttttcccaacctg
aatctcgacaactccgtccacatcactaacctggtcttttccatcttgcgtaacgctcgc
gcgctgcatgtcggtgaagcgccaaatatggtggtctgctggggcggtcactcaattaac
gaaaacgagtatttgtatgcccgtcgcgtcgggaatcagctgggcctgcgtgagctgaat
atctgcaccggctgtggtccgggagcgatggaagcgccgatgaaaggtgctgcggtcgga
cacgcgcagcagcgttacaaagacagtcgctttattggtatgacagagccgtcgattatc
gccgctgaaccgcctaacccgctggtcaacgaattgatcatcatgccagatatcgaaaaa
cgtctggaagcgtttgtccgtatcgctcacggtatcattatcttccctggcggtgtgggt
acagcagaagagttgctgtatttgctgggaattttaatgaacccggccaacaaagatcag
gttttaccattgatcctcaccggcccgaaagagagcgccgactacttccgcgtactggac
gagtttgtcgtgcatacgctgggtgaaaacgcgcgccgccattaccgcatcatcattgat
gacgccgctgaagtcgctcgtcagatgaaaaaatcgatgccgctggtgaaagaaaatcgc
cgcgacactggtgacgcttacagctttaactggtcaatgcgcattgcgccagatttgcaa
atgccgtttgagccgtctcacgagaatatggctaatctgaagctttacccggatcaaccc
gttgaagtgctggctgccgacctgcgccgtgcgttctccggtattgtggcgggtaatgta
aaagaagtcggtattcgcgccattgaagagtttggtccttacaaaatcaacggcgataaa
gagattatgcgtcgtatggacgacctgctacagggttttgttgcccagcatcgtatgaag
ttgccaggctcagcctacatcccttgctacgaaatctgcacataa

DBGET integrated database retrieval system