KEGG   Escherichia coli UM146: UM146_10330Help
Entry
UM146_10330       CDS       T02000                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:elu03016]
    UM146_10330
Enzymes [BR:elu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     UM146_10330
Transfer RNA biogenesis [BR:elu03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    UM146_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2 OSR1_C PilZ
Motif
Other DBs
NCBI-ProteinID: ADN71441
LinkDB All DBs
Structure
PDB: 

Position
2172524..2174458
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
IAVIHSEKERESAEPEELVEPFLTRFVGKVQGKNDRLAIVPDHPLLKDAIPCRAARGLNH
EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVPWWVTLARHNLEKEAPDGVAT
EMLDEGLVREDLTALDFVTIDSASTEDMDDALFAKALPDGKLQLIVAIADPTAWIAEGSK
LDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTFSTDGTIEDNIEF
FAATIESKAKLVYDQVSDWLENTGDWQPESEAIAEQVRLLAQICQRRGEWRHNHALVFKD
RPDYRFILGEKGEVLDIVAEPRRIANRIVEEAMIAANICAARVLRDKLGFGIYNVHMGFD
PANADALAALLKTHGLHVDAEEVLTLDGFCKLRRELDAQPTGFLDSRIRRFQSFAEISTE
PGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATRPQDEITVQMAERRRLNRM
AERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDE
LVCSQENGTVQIKGETAYKVTDVIDVTIAEVRMETRSIIARPVA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggacaacccgctgctagcgcagcttaaacagcaactgcattcccagacgcca
cgcgctgaaggggtggtaaaagccacagaaaaaggctttggcttcctggaagtcgacgcg
caaaaaagttatttcattccgccgccgcagatgaaaaaagtcatgcatggcgaccgaatt
atcgcggtgatccacagtgaaaaagaacgtgaatccgcagagccagaagaactggttgaa
ccgttcctgactcgtttcgtgggtaaagttcagggcaaaaatgaccgtctggccatcgtt
cctgatcatccactcttaaaagacgccattccttgccgcgcagcccgtggcctgaaccac
gagtttaaagaaggcgactgggcggttgccgaaatgcgccgtcatccgctgaaaggcgat
cgttctttctatgctgaactgacacaatacatcacttttggtgacgatcactttgtaccg
tggtgggttacccttgcgcgtcataatctggaaaaagaagcaccagacggcgtcgctacc
gaaatgctcgatgaaggtctggttcgtgaagatctgactgcgctggattttgtcaccatc
gacagtgccagcacagaagatatggatgacgcccttttcgccaaggcgttaccggatggc
aaacttcagctgattgtggcgattgccgatccaaccgcgtggattgctgaaggcagcaag
ctggacaaagccgcgaaaattcgcgcattcaccaactatctgcctggcttcaacatccct
atgctgcctcgcgagctttctgacgatctctgctcactgcgcgccaatgaagtccgcccg
gtactggcatgccgcatgacgttctccactgatggcaccattgaagataatatcgaattc
tttgccgccaccatcgaatccaaagcgaagctggtgtatgaccaggtttctgactggctg
gaaaataccggtgactggcagcctgaaagcgaagcaattgccgaacaagtccgtttgcta
gcgcaaatatgccaacgccgcggcgagtggcgtcataaccacgcactggtgtttaaagat
cgcccggattaccgctttattctcggtgaaaaaggtgaagtgctggatatcgtcgccgag
cctcgtcgcattgccaaccgtatcgtcgaagaagcgatgattgccgctaacatttgtgcg
gcccgcgtactgcgcgataagctcggttttggcatctataacgtgcatatgggctttgat
ccggcgaatgccgacgcgttggcagcgttgctgaaaacgcacggtctgcatgtcgatgct
gaagaagtgctcacgctggacggtttctgcaaactgcgtcgtgaactggatgcgcaacca
actggtttcctcgacagccgcattcgtcgcttccagtcatttgctgaaattagcactgaa
cccggtcctcactttggcctcggtctggaagcatacgccacctggacttcgccgatccgt
aaatatggcgacatgatcaaccaccgtctgctgaaagcggttatcaaaggcgaaactgcg
acgcgtccacaggatgaaatcactgtccaaatggccgagcgtcgccgtctcaaccggatg
gcagaacgtgatgttggcgactggttatacgcacgcttcctgaaagacaaagccgggacc
gacacccgtttcgcggcggaaattgtcgatatcagccgtggcggcatgcgtgttcgtttg
gttgataacggcgctatcgcctttattccagcacctttcttacacgctgtgcgcgatgaa
ctggtttgcagccaggaaaacggcactgtacaaattaaaggtgaaacggcttacaaagtg
actgacgttattgacgtcaccattgccgaagtccgcatggaaacccgcagcattattgcg
cgcccggtcgcgtaa

DBGET integrated database retrieval system