KEGG   Escherichia coli UM146: UM146_19000Help
Entry
UM146_19000       CDS       T02000                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
elu  Escherichia coli UM146
Pathway
elu00290  Valine, leucine and isoleucine biosynthesis
elu00770  Pantothenate and CoA biosynthesis
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01130  Biosynthesis of antibiotics
elu01210  2-Oxocarboxylic acid metabolism
elu01230  Biosynthesis of amino acids
Module
elu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
elu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    UM146_19000
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    UM146_19000
Enzymes [BR:elu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     UM146_19000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ADN73140
LinkDB All DBs
Position
3956408..3958258
Genome map
AA seq 616 aa AA seqDB search
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ
SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIV
ELTKRYYEQDDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT
LEQYDIIVTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRSNGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL
IEDGDLIAIDIPNRGIQLQVSDAELAARREAQEARGDKAWTPKNRERQVSFALRAYASLA
TSADKGAVRDKSKLGG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcg
ctgtggcgcgccaccggaatgaccgacgccgatttcggtaagccgattatcgcggttgtg
aactcgttcacccaatttgtaccgggtcacgtccatctacgcgatctcggtaaactggtt
gccgaacaaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggat
gatgggatcgctatgggccacgggggcatgctttattcactgccatctcgcgaactgatc
gctgattccgttgaatatatggtcaacgcccactgcgccgacgccatggtctgcatctct
aactgcgacaaaatcaccccggggatgctgatggcttccctgcgcctgaatattccggtg
atctttgtttccggcggcccgatggaggccgggaaaaccaaactgtccgatcagatcatt
aagctcgatctggttgatgcgatgatccagggcgcagacccgaaagtttctgactcccag
agcgatcaggttgaacgatccgcctgcccaacctgcggttcctgctccgggatgtttact
gctaactcaatgaactgcctgaccgaagcgctgggcctgtcgcagccgggcaacggctcg
ctgctggcaacccacgctgatcgcaagcaactgttcctcaatgctggtaaacgcattgtt
gaattgaccaaacgttactacgaacaggatgatgaaagcgcactgccgcgtaacatcgcc
agtaaggcggcgtttgaaaacgccatgacgctggatatcgcgatgggcggctctaccaac
accgttctccacctgctggcggcggcgcaggaagcggaaatcgacttcaccatgagtgat
atcgataagctctcccgcaaagtaccgcagctgtgtaaagttgcgccgagcacccaaaaa
taccatatggaagatgttcaccgtgctggtggtgttatcggtattctcggcgagctggat
cgtgcggggttactgaaccgtgatgtgaaaaatgtacttggcctgacgttgccgcaaacg
ctggaacaatacgacatcatcgtgacccaggatgatgcggtaaaaaatatgttccgcgct
ggcccggcgggcattcgtactacacaggcattctcgcaggattgccgctgggatacgctg
gacgacgatcgctccaatggctgtatccgctcgctggaacacgcctacagcaaagacggc
ggcctggcggtgctctacggtaatttcgcagaaaacggctgcatcgttaaaaccgcaggc
gtcgatgacagcatcctcaaattcactggcccggcgaaagtctacgaaagccaggacgac
gcggtagaagcgattctcggcggtaaagttgtcgccggagatgtggtagtaattcgctat
gaaggcccgaaaggcggtccggggatgcaggaaatgctctacccaaccagtttcctgaaa
tcaatgggtctcggtaaagcctgtgcgctgatcaccgacggtcgtttctctggcggcacc
tctggtctttccatcggccacgtctcaccggaagcggcaagtggcggcagcattggcctg
attgaagatggtgacctgatcgctatcgacattccgaaccgtggcattcagttacaggta
agcgatgccgaactggcggcgcgtcgtgaagcgcaggaagctcggggtgacaaagcctgg
acgccgaaaaaccgtgaacgtcaggtttcctttgcgctgcgtgcctacgccagcctggca
accagcgccgacaaaggcgcggtgcgcgataaatcgaaactggggggttaa

DBGET integrated database retrieval system