KEGG   Escherichia coli UM146: UM146_19770Help
Entry
UM146_19770       CDS       T02000                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
elu  Escherichia coli UM146
Brite
Enzymes [BR:elu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UM146_19770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TGF_beta_GS DUF4600
Motif
Other DBs
NCBI-ProteinID: ADN73286
LinkDB All DBs
Structure
PDB: 

Position
4119058..4119678
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AASRFGSGWAWLVQKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttataccctgccatccctgccgtatgcttacgatgccctggaaccgcacttcgat
aagcagaccatggaaatccaccacaccaaacaccatcaggcctacgttaacaacgccaac
gcggcgctggaaagcctgccagaattcgctaacctgccggttgaagagctgatcaccaaa
ctggaccaactgccagcagacaagaaaaccgtactgcgcaataacgctggtggtcacgct
aaccacagcctgttctggaaaggtctgaaaaaaggcaccaccctgcagggtgacctgaaa
gcggctatcgaacgtgacttcggctccgttgataacttcaaagcagaatttgagaaagcg
gcagcttcccgctttggttccggctgggcatggctggtgcaaaaaggcgataaactggcg
gtggtttctactgctaaccaggactctccgctgatgggcgaagccatttctggcgcttcc
ggcttcccgattctgggcctggatgtgtgggaacatgcttactacctgaaattccagaac
cgccgtccggactacattaaagagttctggaacgtggtgaactgggacgaagcagcggca
cgtttcgcagcgaaaaaataa

DBGET integrated database retrieval system