KEGG   Escherichia coli W: ECW_m0558Help
Entry
ECW_m0558         CDS       T02002                                 

Gene name
ybaS
Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
elw  Escherichia coli W
Pathway
elw00220  Arginine biosynthesis
elw00250  Alanine, aspartate and glutamate metabolism
elw00471  D-Glutamine and D-glutamate metabolism
elw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECW_m0558 (ybaS)
   00220 Arginine biosynthesis
    ECW_m0558 (ybaS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECW_m0558 (ybaS)
Enzymes [BR:elw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ECW_m0558 (ybaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADT74091
UniProt: E0J6R9
LinkDB All DBs
Structure
PDB: 

Position
589685..590617
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGKVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggtcaaaatgccgactacattccctttctggcgaatgtgcctggtcaactg
gcggcagtggctatcgtgacctgcgatggcaaggtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaggatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgcc
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcctc
aatactgttgaactggcaacacttggcgcgacgctggcggcggggggagtgaatccgctg
acgcataaacgcgttcttcaggccgataacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcatatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggtgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system