KEGG   Escherichia coli W: ECW_m0689Help
Entry
ECW_m0689         CDS       T02002                                 

Gene name
mrdA
Definition
(GenBank) transpeptidase involved in peptidoglycan synthesis (penicillin-binding protein 2)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
elw  Escherichia coli W
Pathway
elw00550  Peptidoglycan biosynthesis
elw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECW_m0689 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ECW_m0689 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elw01011]
    ECW_m0689 (mrdA)
Enzymes [BR:elw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECW_m0689 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:elw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ECW_m0689 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADT74217
UniProt: E0J1W1
LinkDB All DBs
Structure
PDB: 

Position
complement(737117..739018)
Genome map
AA seq 633 aa AA seqDB search
MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQTRSNENRIK
LVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDALRSVVDLTDDDIAAFR
KERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPYGSALTHVIGYVS
KINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLK
EVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTGGVLALVSTPSYDPNLFVDG
ISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSALSAGVITRNTTLFDPGWWQL
PGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDMGIDRLSEWMGKFGYGHYTGID
LAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKV
PHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKDGMYGVANRPNGTAHKYFASAPYK
IAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTAFAPYNNPQVAVAMILENGGAGPAV
GTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacagaactcttttcgcgactatacggcagagtccgcgctgtttgtgcgccgg
gcgctggtcgcctttttggggattttgctgctgaccggcgtgcttatcgccaacctgtat
aatctgcaaattgttcgctttaccgactaccagacccgctctaatgaaaaccgcattaag
ctggtgcctatcgcgcccagccgcggcattatctacgaccgtaacggtatccctctggcc
ctcaaccgcactatctaccagatagaaatgatgccggagaaagtcgataacgtgcagcaa
acgctggacgctttgcgcagcgtggtagatctgaccgatgacgatattgctgcattccga
aaagagcgcgcacgttcacaccgtttcacctctattccggtgaaaactaacctgaccgaa
gtacaagtagctcgctttgccgtcaatcagtaccgttttccgggggttgaagttaaaggc
tataaacgtcgttactatccttacggttcggcgttgacccacgtcatcggctatgtgtcg
aaaatcaacgataaagacgtcgaacgcctgaataatgacggcaaactggccaactatgcg
gcaacgcatgatatcggtaagctgggcattgagcgttactatgaagacgtgctgcacggt
cagaccggttatgaagaggttgaagttaacaaccgtgggcgtgttattcgccagttaaaa
gaagtaccaccgcaagccggacacgatatttacctgacgctggatctcaaactccagcaa
tatattgaaacgctgctggcgggtagccgcgcagctgttgtagtcaccgatccgcgtaca
ggtggggtgctggcgctggtttccacgcctagttatgacccaaacctatttgttgacggt
atctccagcaaagattattccgccttgctgaatgacccgaatacaccgctggtgaaccgc
gccacacagggggtttatcctcccgcgtctacagttaaaccctatgtggcggtttcggca
ttgagcgccggggtgatcacgcgcaatacgacgctgtttgacccaggctggtggcaactg
ccaggttcggaaaaacgttatcgtgactggaaaaaatggggccacgggcgtctgaatgtc
acaagatcgctggaagaatctgcggataccttcttctatcaggtggcctacgatatgggg
atcgatcgcctctccgaatggatgggtaaattcggttatggtcattataccggtatcgac
ctggcggaagaacgttccggcaacatgcctacccgcgaatggaaacagaaacgctttaaa
aaaccgtggtatcagggtgacaccattccggttggtatcggtcagggttactggacagcg
accccaatccagatgagtaaggcactgatgatcctgattaatgacggtatcgtgaaggtt
ccgcatttgctgatgagcaccgccgaagacggcaaacaggtgccatgggtacaaccgcat
gaaccgcccgtcggcgatattcattccggttactgggagctggcgaaagacggtatgtac
ggtgttgctaaccgccctaacggtacggcgcataaatactttgccagcgcaccgtacaaa
attgcggcgaaatccggtaccgctcaggtcttcggtctgaaagcgaacgaaacctataat
gcgcacaaaattgccgagcgtttacgtgaccacaaactgatgaccgcctttgcgccatac
aacaatccgcaagtggctgtcgccatgattctggagaacggcggcgcgggtccggcggtt
ggtacgctgatgcgtcagatcctcgaccacattatgctgggtgataacaacaccgatctg
cctgcggaaaatcctgcggttgccgcagcggaggaccattaa

DBGET integrated database retrieval system