KEGG   Escherichia coli W: ECW_m0822Help
Entry
ECW_m0822         CDS       T02002                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
elw  Escherichia coli W
Pathway
elw00030  Pentose phosphate pathway
elw01100  Metabolic pathways
elw01110  Biosynthesis of secondary metabolites
elw01120  Microbial metabolism in diverse environments
elw01130  Biosynthesis of antibiotics
elw01200  Carbon metabolism
Module
elw_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
elw_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
elw_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECW_m0822 (pgl)
Enzymes [BR:elw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     ECW_m0822 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL
Motif
Other DBs
NCBI-ProteinID: ADT74330
UniProt: E0J4F5
LinkDB All DBs
Structure
PDB: 

Position
868852..869847
Genome map
AA seq 331 aa AA seqDB search
MKQTVYIASPESQQIHVWNLNHEGALTLTQVVDVPGQVQPMVVSPDKRYLYVGVRPEFRV
LAYRIAPDDGALTFAAESALPGSPTHISTDHQGQFVFVGSYNAGNVSVTRLEDGLPVGVV
DVVEGLDGCHSANISPDNRTLWVPALKQDRICLFTVSDDGHLVAQDPAEVTTVEGAGPRH
MVFHPNEQYAYCVNELNSSVDVWELKDPHGNIECVQTLDMMPENFSDTRWAADIHITPDG
RHLYACDRTASLITVFSVSEDGSVLSKEGFQPTETQPRGFNVDHSGKYLIAAGQKSHHIS
VYEIVGEQGLLHEKGRYAVGQGPMWVVVNAH
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaacagtttatatcgccagccctgagagccagcaaattcacgtctggaacctg
aatcatgaaggcgcactgacgctgacacaggttgtcgatgtgccggggcaggtgcagccg
atggtggtcagcccggacaaacgttatctctatgttggtgttcgccctgagtttcgcgtc
ctggcgtatcgtattgccccggacgatggcgcactgacctttgccgcagagtctgcgctg
ccgggtagtccgacgcatatttccaccgatcaccaggggcagtttgtctttgtaggttct
tacaatgcgggtaacgtgagcgtaacgcgtctggaagatggcctgccagtgggcgtcgtc
gatgtggtcgaggggctggacggttgccattccgccaatatctcaccggacaaccgtacg
ctgtgggttccggcattaaagcaggatcgcatttgcctgtttacggtcagcgatgatggt
catctcgtggcgcaggaccctgcggaagtgaccaccgttgaaggggccggcccgcgtcat
atggtattccatccaaacgaacaatatgcgtattgcgtcaatgagttaaacagctcagtg
gatgtctgggaactgaaagatccgcacggcaatatcgaatgtgtccagacgctggatatg
atgccggaaaacttctccgatacccgttgggcggctgatattcatatcaccccggatggg
cgtcacttatatgcctgtgaccgtactgccagcctgattactgtcttcagcgtttcggaa
gatggcagcgtgttgagtaaagaaggcttccagccaacggaaacccagccgcgcggcttc
aatgttgatcacagcggcaagtatctgattgccgctgggcaaaaatctcaccacatctcg
gtatacgaaattgttggcgagcaggggctactgcatgaaaaaggccgctatgcggtcggg
cagggaccaatgtgggtggtggttaacgcacactaa

DBGET integrated database retrieval system