KEGG   Escherichia coli W: ECW_m1810Help
Entry
ECW_m1810         CDS       T02002                                 

Gene name
slyA
Definition
(GenBank) DNA-binding transcriptional activator
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
elw  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:elw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elw03000]
    ECW_m1810 (slyA)
Transcription factors [BR:elw03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    ECW_m1810 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 HTH_20 B-block_TFIIIC HxlR HTH_5 HTH_24 TrmB HTH_36 LexA_DNA_bind Replic_Relax DUF4423 GntR RP-C GlnD_UR_UTase DUF2250 RsbU_N Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: ADT75277
UniProt: E0IWR5
LinkDB All DBs
Position
complement(1866677..1867111)
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLITLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtactctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccactgatc
agcgaaatggaagctgttattaacaaaacccgcgcggaaatattacatggcatctccgca
gaggaactggagcaactgattacgctcatcgcaaaacttgagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system