KEGG   Escherichia coli W: ECW_m1943Help
Entry
ECW_m1943         CDS       T02002                                 

Gene name
ydjJ
Definition
(GenBank) predicted oxidoreductase, Zn-dependent and NAD(P)-binding protein
Organism
elw  Escherichia coli W
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 Cupin_2 ThiF
Motif
Other DBs
NCBI-ProteinID: ADT75404
UniProt: E0IXC1
LinkDB All DBs
Structure
PDB: 

Position
complement(2003949..2004992)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLIMAEQLGATVVINGTKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
ataccagtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggcccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgcgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgcca
gacaatatggacacgatggaaggggcgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggcgcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctgataatggcggaacaacttggtgcgacagtggttattaacggc
acaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgc
ggcggtaaaattatgattgttggtactgtacccggcgattcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagctatttcttcagggcgattcgatgtgaaatcgatggtgacgcatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaaaattagcgattaa

DBGET integrated database retrieval system