KEGG   Escherichia coli W: ECW_m2622Help
Entry
ECW_m2622         CDS       T02002                                 

Gene name
yfeO
Definition
(GenBank) predicted ion channel protein
Organism
elw  Escherichia coli W
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Voltage_CLC
Motif
Other DBs
NCBI-ProteinID: ADT76051
UniProt: E0J7K0
LinkDB All DBs
Position
2694087..2695343
Genome map
AA seq 418 aa AA seqDB search
MLHPRARTMLLLSLPAVAIGIASSLILIVVMKIASVLQNLLWQRLPGTLGIAQDSPLWII
GVLTLTGIAVGLVIRFSQGHAGPDPACEPLIGAPVPPSALPGLIVALILGLAGGVSLGPE
HPIMTVNIALAVAIGARLLPRVNRMEWTILASAGTIGALFGTPVAAALIFSQTLNGSSEV
PLWDRLFAPLMAAAAGALTTGLFFHPHFSLPIAHYGQMEMTDILSGAIVAAIAIAAGMVA
VWCLPRLHAMMNQMKNPVLVLGIGGFILGILGVIGGPVSLFKGLDEMQQMVANQAFSTSD
YFLLAVIKLTALVVAAASGFRGGRIFPAVFVGVALGLMLHEHVPAVPAAITVSCAILGIV
LVVTRDGWLSLFMAAVVVPNTTLLPLLCIVMLPAWLLLAGKPMMMVNRPKQQPPHDNV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgctccatccgcgagccagaaccatgttgttattatcgctccccgccgtggcaattggg
attgcgtccagtcttattctgattgtggtgatgaaaatcgcctcggtattacagaatttg
ctctggcaacgactgccgggaactctggggatagcccaggattcacctctctggatcatc
ggtgtattaacgctaacgggtattgcggtggggttggttatccgtttcagccagggtcat
gccggaccagaccccgcctgtgaaccgctgatcggcgcaccagttccgccctctgcgcta
ccaggacttatcgtagcattaattctcggtcttgctggcggcgtcagcctggggccggaa
catccgatcatgaccgtcaatatcgcccttgccgtcgccattggcgctcgtctgttaccg
cgcgtcaaccgaatggagtggactattttagcctctgccggaaccatcggcgcgctgttt
ggtacacctgttgcggcggcgttgatattttcgcaaaccttaaatggcagtagtgaagtt
ccgctatgggatcgtctttttgcgccgttaatggcggcagcagctggtgcacttactacc
ggattatttttccatccccatttttcactgcccattgcgcattacggacagatggaaatg
accgatattctcagtggtgcaattgtcgcggcgattgccatcgcagcagggatggtcgcc
gtatggtgcttaccacggttgcacgcgatgatgaatcaaatgaaaaatccggtgctcgtg
ctgggtattggcggatttattctcggaattctgggggttattggtggaccagtttcgctg
tttaaagggctggatgagatgcagcagatggtggcaaatcaggctttcagcaccagcgat
tattttttgctggcggtgattaaacttaccgccctggtcgttgctgccgccagtggcttt
cgcggtgggcgaatcttcccggcagtgtttgtcggcgtggcattagggttgatgctgcat
gagcacgttcccgccgttccagcggcaataaccgtttcctgcgctattctcggcatcgtg
ctagtggtaacacgcgatggctggttaagtctttttatggcggcagtcgttgtacccaat
accacattgctaccgctgctctgtatcgtcatgctcccagcatggctgttattagcaggt
aagccgatgatgatggtcaatcgtccgaagcaacagccaccccacgataacgtttag

DBGET integrated database retrieval system