KEGG   Escherichia coli W: ECW_m2859Help
Entry
ECW_m2859         CDS       T02002                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
elw  Escherichia coli W
Pathway
elw00250  Alanine, aspartate and glutamate metabolism
elw00280  Valine, leucine and isoleucine degradation
elw00310  Lysine degradation
elw00410  beta-Alanine metabolism
elw00640  Propanoate metabolism
elw00650  Butanoate metabolism
elw01100  Metabolic pathways
elw01120  Microbial metabolism in diverse environments
Module
elw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECW_m2859 (gabT)
   00650 Butanoate metabolism
    ECW_m2859 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECW_m2859 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECW_m2859 (gabT)
   00310 Lysine degradation
    ECW_m2859 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECW_m2859 (gabT)
Enzymes [BR:elw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECW_m2859 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECW_m2859 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ECW_m2859 (gabT)
Amino acid related enzymes [BR:elw01007]
 Aminotransferase (transaminase)
  Class III
   ECW_m2859 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADT76270
UniProt: E0J5N7
LinkDB All DBs
Structure
PDB: 

Position
2938851..2940131
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAGIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIINQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcagttcctcgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccaggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgccgccacaaaacgtagcggcaccatcgcttttagcggcgcgtaccacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgcctgggcacgtttatcgcgcgctttatccttgcccgctgcacggcatcagtgaa
gatgacgctatcgccagcattcaccgaatttttaaaaatgacgctgcgccggaagatatc
gccgccatcgtgattgaaccggttcagggcgaaggcggtttctacgccgctacgcctgct
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcaccacctttgcgaaatccatcgcgggcggcttcccgctggcgggtgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcgggctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctgaaagatggactgctggcgattgccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgggatcgtggcgcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcaaccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system