KEGG   Escherichia coli W: ECW_m3054
Entry
ECW_m3054         CDS       T02002                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
elw  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:elw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elw02044]
    ECW_m3054
Secretion system [BR:elw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECW_m3054
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADT76445
UniProt: E0IWL0
LinkDB
Position
3133493..3134572
AA seq 359 aa
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDNPATDAVRFRPHPGM
GFPVSELKNVERDAGNPDVPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLD
IFNHRFITQYYRIWRKYNYPASFEAGAMDDISRCLLGLIGLGIPGSENHIATPVSRFLAL
LSVMRLPTRTAEGVTALVGLLAPLTKATVVPHDPQPVILPAPAGLSKNSRISLKTRTLLG
RTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLRVYLGWRCQARLQLTLPVSLL
PAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPALSIRNRESMTHVSYSF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggacagagcatcacagccagcgcgtaccgggctgaccgaccggctggccccggatatt
gcgcggatcaatttttaccgtttttgccagttgctggaacagagccagcagaacgcgccg
ctgggcagtaccgacaaccccgccaccgatgcggtgcgctttcgtccccatcccggaatg
ggctttccggtcagcgagttaaagaacgttgaacgtgacgcgggcaatcccgacgtgcca
cccacggtgcgcaccacctttctcggcctgtacggcgtggattcgccgctgccaaccgcc
tatctggactacattacccagcgtcatgacggacatgacgcagtgatggcgtttctcgat
atttttaaccatcgctttatcacccagtattaccgcatctggcgcaaatataactacccg
gcgtcgtttgaagcaggtgctatggatgacatttcccgttgtctgctgggactcatcggg
ctgggtattcccggcagcgagaaccatatcgccacgccggtatcccgttttctggccctg
ctcagcgtgatgcgcctgccgacgcgcacggcggaaggcgtcacggcactggtgggactg
cttgccccgctgacgaaagcgacggtggtgcctcacgatccgcagcctgttattctcccg
gcccctgcgggtctgtcaaaaaattcacgcatcagcctgaaaacgcgaacgctgctgggg
cgtaccggcaccgacgtcaacagccagttgctgctgaaactgtataccgaagatgccgca
gaagcacgtggctggctacctggcgggcagctgcacagcgatttgctggtgctgctgcgc
gtttatctgggctggcgctgtcaggcccgtctgcaactgacgctgcccgtcagcctgttg
cctgctgcccggctgggaaaacagcgcgtacagattagccgtaccggcatccttcgcgcc
tcctttgccgcgcccgcgaccggaacagtgacggtcagtctggggcgttatcagggatta
atacccgctttatccattcgtaacagggagagtatgactcatgtttcctattcgttttaa

DBGET integrated database retrieval system