KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0764Help
Entry
CDCO157_0764      CDS       T02122                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00010  Glycolysis / Gluconeogenesis
elx00052  Galactose metabolism
elx01100  Metabolic pathways
elx01110  Biosynthesis of secondary metabolites
elx01120  Microbial metabolism in diverse environments
elx01130  Biosynthesis of antibiotics
Module
elx_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDCO157_0764 (galM)
   00052 Galactose metabolism
    CDCO157_0764 (galM)
Enzymes [BR:elx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CDCO157_0764 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFJ27811
UniProt: A0A0F6C0Q5
LinkDB All DBs
Position
complement(872679..873719)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGKQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNYLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLHPGEEYSSLTEYQFIAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacgaaactcccgcactggcacccgatggtcagccgtaccgactgttaactttg
cgtaacaacgcagggatggtagtcacgctgatggactggggtgcgactttactttcagcc
cgtattccgctttccgatggcagcgtccgcgaggcgctgctcggctgtgccagcccggaa
tgctatcaggatcaggccgcgtttctgggtgcctctattggtcgttatgccaaccgcatc
gccaatagtcgttatacctttgacggtgaaaccgtgacgctttcgccaagtcagggcgtt
aaccagctgcacggcggcccggaagggttcgacaaacgtcgctggcagattgtgaaccag
aacgatcgtcaggtgctgtttgccctgagttcagatgatggcgatcagggcttcccgggt
aatctcggcgcgacggtgcaatatcgtctgaccgacgataaccgtatctccattacttat
cgcgccacagttgataaaccttgcccggtgaatatgactaatcacgtctatttcaatctt
gacggcaagcagtctgacgtgcgcaatcacaagttgcagattctggcggacgaatatctg
ccggttgatgaaggcggtattccgcacgacggcctgaaatctgtcgccggaacgtctttt
gatttccgcagcgccaaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaa
gtgaaaggttacgatcacgcattcttgttacaggccaaaggcgatggcaagaaagtggcg
gcgcatgtctggtcagcagatgaaaaattgcagctgaaggtctacaccaccgctccggct
ctgcaattctactccggcaactacctcggcggcacaccgtcgcggggaaccgaaccttac
gccgactggcaagggctggcgttggaaagcgagtttctgccggacagcccgaaccaccct
gaatggccgcaaccggactgtttcctgcatcctggtgaagagtattccagcctgacggaa
tatcagtttattgctgagtaa

DBGET integrated database retrieval system