KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0828
Entry
CDCO157_0828      CDS       T02122                                 

Definition
(GenBank) hypothetical protein
  KO
K23656  T3SS secreted effector NleD
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:elx00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_0828
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: AFJ27876
LinkDB
Position
929604..930302
AA seq 232 aa
MRPTSLNLVLHQSSRSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRAESQKYSPLLLEEARTVG
LGAFSEEVLSENKFHEEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaaggtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgagcagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaggaggtgctttcagaaaataaattccacgaagagattgggatg
ccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system