KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_1086Help
Entry
CDCO157_1086      CDS       T02122                                 

Definition
(GenBank) putative copper/zinc-superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Brite
Enzymes [BR:elx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CDCO157_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFJ28131
UniProt: A0A0F6C1M5
LinkDB All DBs
Position
complement(1203717..1204244)
Genome map
AA seq 175 aa AA seqDB search
MKCKIIAAIAMLTAASCGYAAEQEVPMNLVSADGKEVSIGKITIQETPYGLLFTPALHSL
SEGIHGFHVHEKGNCAPALKDGKPVAALSAGGHFDPKNTGKHLGPWSPDGHPGDLPALFV
THDGKANYPVLAPRLNSLKEIKGRSLMLHAGGDNHHDHPEPLGGGGARMACGIIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtaaaatcattgctgccattgccatgctgacagcagcatcatgcggatacgca
gcagaacaggaagtcccaatgaaccttgtcagtgctgacggaaaagaagtcagcattgga
aaaataaccattcaggagaccccctacggtctgctgttcacaccagcccttcactctctg
tctgaaggcattcatggttttcatgtgcacgaaaaaggaaattgcgccccggcactgaaa
gacggaaaaccggtcgcagcattatcggctggcggtcactttgacccgaaaaacaccggc
aaacatcttggcccctggtctccggatggacacccgggcgacctccctgcgctgttcgtg
acgcatgacggaaaagcgaactacccggtcctggccccgagactgaactcattaaaagag
attaaagggcgttctctcatgcttcatgctggcggtgataaccatcatgaccatccggag
cccctgggcggtggtggtgcgagaatggcctgcggcatcattcaataa

DBGET integrated database retrieval system