KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_1155
Entry
CDCO157_1155      CDS       T02122                                 

Definition
(GenBank) Shiga toxin 2 subunit B
  KO
K11007  shiga toxin subunit B
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx02024  Quorum sensing
elx05130  Pathogenic Escherichia coli infection
Module
elx_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:elx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CDCO157_1155
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_1155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:elx02042]
    CDCO157_1155
Bacterial toxins [BR:elx02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    CDCO157_1155
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 Porin_7 PCC_BT
Other DBs
NCBI-ProteinID: AFJ28216
LinkDB
Structure
PDB: 
4M1U 1R4P 3MXG

Position
1271184..1271453
AA seq 89 aa
MKKMFMAVLFALASVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagcttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system