KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2185Help
Entry
CDCO157_2185      CDS       T02122                                 

Definition
(GenBank) transcriptional regulator SlyA
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Brite
KEGG Orthology (KO) [BR:elx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elx03000]
    CDCO157_2185
Transcription factors [BR:elx03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    CDCO157_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 HTH_20 B-block_TFIIIC HxlR HTH_5 HTH_24 TrmB HTH_36 LexA_DNA_bind Replic_Relax DUF4423 GntR RP-C GlnD_UR_UTase DUF2250 RsbU_N Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: AFJ29240
UniProt: A0A0F6C4T4
LinkDB All DBs
Position
complement(2270944..2271378)
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLITLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtactctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccgctgatc
agcgaaatggaagctgttattaacaaaacccgcgcggaaattttacatggcatctccgca
gaggaactggaacaactgattacgctcatcgcaaaactagagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system