KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2457Help
Entry
CDCO157_2457      CDS       T02122                                 

Definition
(GenBank) cystine transporter subunit
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:elx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CDCO157_2457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elx02000]
    CDCO157_2457
   02035 Bacterial motility proteins [BR:elx02035]
    CDCO157_2457
Transporters [BR:elx02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    CDCO157_2457
Bacterial motility proteins [BR:elx02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    CDCO157_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: AFJ29513
UniProt: A0A0F6C5K7
LinkDB All DBs
Position
complement(2551565..2552365)
Genome map
AA seq 266 aa AA seqDB search
MKLAHLGRQALMGVMAVALIAGMSVKSFADEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVN
DAIAEMQKDGTLQALSEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacatctgggacgtcaggcattgatgggtgtgatggccgtagcgctgatt
gcgggcatgagcgttaaaagttttgcagatgaaggtctgcttaataaagttaaagagcgc
ggcacgctgctggtagggctggaaggtacttatccgccgttcagttttcagggggatgac
ggcaaattaaccggttttgaagtggaatttgcccaacagctggcaaaacatcttggcgtt
gaggcgtcactaaaaccgaccaaatgggacggtatgctggcgtcgctggactctaaacgt
attgatgtggtgattaatcaggtcaccatttctgatgagcgcaagaaaaaatacgatttc
tcaaccccgtacaccatttctggtattcaggcgctggtgaaaaaaggtaacgaaggcacc
attaaaacagccgatgatctgaaaggcaaaaaagtgggggtcggtctgggcaccaactat
gaagagtggctgcggcagaatgttcagggcgtcgatgtgcgtacctatgatgatgacccg
accaaatatcaggatctgcgcgtagggcgtatcgatgcgatcctcgttgatcgtctggcg
gcgctggatctggtgaagaaaaccaacgatacgctggcagtaaccggtgaagcattctcc
cgtcaggagtctggcgtggcgctgcgtaaaggaaatgaagacctgctgaaagcagtgaat
gatgcaattgcggaaatgcaaaaagacggcactttgcaagccctttccgaaaaatggttt
ggtgctgatgtgaccaaataa

DBGET integrated database retrieval system