KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2654
Entry
CDCO157_2654      CDS       T02122                                 

Definition
(GenBank) 3-methyl-adenine DNA glycosylase II
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:elx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CDCO157_2654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:elx03400]
    CDCO157_2654
Enzymes [BR:elx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     CDCO157_2654
DNA repair and recombination proteins [BR:elx03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CDCO157_2654
SSDB
Motif
Pfam: AlkA_N HhH-GPD
Other DBs
NCBI-ProteinID: AFJ29712
LinkDB
Structure
PDB: 

Position
complement(2752248..2753096)
AA seq 282 aa
MYTLNWQPPYDWSWMLGFLAARAVSGVETVADDYYARSLAVGEYRGVVTAIPDIARHTLH
INLSADLEPVAAECLAKMSRLLDLQCNPQIVNGALGKLGAARPGLRLPGSVDAFEQGVRA
ILGQLVSVAMAAKLTAKVVQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAE
ALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYL
IKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtataccctgaactggcagccgccgtatgactggtcgtggatgttgggatttctcgcc
gcccgtgcagtgagtggtgtggaaacggtcgctgacgattattatgcccgtagtctggcg
gtgggcgaatatcgcggcgtggtgactgctattccggatatagcccgccatactctgcac
ataaatttaagtgcagatttagaacccgttgccgctgagtgtctggcgaaaatgagccgc
ctgcttgatctgcaatgtaacccgcagattgttaacggtgcgttgggcaagttaggcgcg
gcgcggcccggattgcgtttacccggcagtgttgatgcttttgagcaaggcgtgcgggcg
attttaggccaactggtgagcgtggcgatggcggcaaaattgactgccaaagtggtacag
ctttatggcgaacggctggatgattttccggagtatatctgcttccccacgcctcagcgg
ctggcagcagcagacccgcaggcattaaaagcgttaggtatgccgttgaaacgggcagag
gcgctgattcatctggcaaatgcggcgctggagggcaccttaccaatgacaataccgggc
gatgtggagcaggcgatgaaaacgctgcaaacttttccgggtatcgggcgctggacggcg
aattattttgctttgcgtggctggcaggcgaaagatgttttcctgccggatgattatctg
attaaacagcgatttccgggaatgacaccggcgcaaatccgccgttatgccgagcgctgg
aagccctggcgttcttatgcgctgttgcatatctggtatacggaaggctggcaaccagac
gaagcatga

DBGET integrated database retrieval system