KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2738
Entry
CDCO157_2738      CDS       T02122                                 

Definition
(GenBank) Shiga toxin I subunit B precursor
  KO
K11007  shiga toxin subunit B
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx02024  Quorum sensing
elx05130  Pathogenic Escherichia coli infection
Module
elx_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:elx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CDCO157_2738
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_2738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:elx02042]
    CDCO157_2738
Bacterial toxins [BR:elx02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    CDCO157_2738
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-ProteinID: AFJ29798
LinkDB
Structure
PDB: 
1C4Q 1D1I 2XSC 1CQF 1QNU

Position
complement(2852575..2852844)
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system