KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3090Help
Entry
CDCO157_3090      CDS       T02122                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00620  Pyruvate metabolism
elx01100  Metabolic pathways
elx01120  Microbial metabolism in diverse environments
elx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDCO157_3090
Enzymes [BR:elx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     CDCO157_3090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AFJ30147
UniProt: A0A0F6C7E1
LinkDB All DBs
Position
complement(3219859..3222138)
Genome map
AA seq 759 aa AA seqDB search
MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFI
EVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAY
AVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
EVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKL
TEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIE
MRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIG
AIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYV
NDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAP
ELMIDGEMHGDAALVEAIRNDRMPDSPLKGSANILVMPNMEAARISYNLLRVSSSEGVTV
GPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccagttaaaacaaagtgcacttgatttccatgaatttccagttccagggaaa
atccaggtttctccaaccaagcctctggcaacgcagcgcgatctggcgctggcctactca
ccaggcgttgccgcaccttgtcttgaaatcgaaaaagacccgttaaaagcctacaaatat
accgcgcgcggtaacctggtggcggtgatctctaacggtacggcggtgctggggttaggc
aacattggcgcgctggcaggcaaaccggtgatggaaggcaagggcgttctgtttaagaaa
ttcgctgggattgatgtatttgacattgaagttgatgaactcgacccggacaaatttatt
gaagtcgtcgctgcgctcgaaccgaccttcggcggcatcaacctcgaagacattaaagcg
ccagaatgtttctatattgaacagaaactgcgcgagcggatgaatattccggtattccac
gacgatcagcacggcacggcaattatcagcactgccgccatcctcaacggcttgcgcgtg
gtggagaaaaacatctctgacgtgcgtatggtggtttccggcgcgggtgctgcagcaatc
gcctgtatgaacctgctggtagcgttgggtctgcaaaaacataacatcgtggtttgcgat
tcaaaaggcgttatctatcagggccgtgagccaaacatggcggaaaccaaagccgcatat
gcggtagtggatgacggcaaacgtaccctcgatgatgtgattgaaggcgcagatattttc
ctcggctgttccggcccgaaagtgctgacccaggaaatggtgaagaaaatggctcgagcg
ccaatgatcctggcgctggcgaacccggaaccggaaattctgccgccgctggcgaaagaa
gtgcgtccggatgccatcatctgtaccggccgttccgactacccgaaccaggtgaacaac
gtcctttgcttcccgttcatcttccgtggcgcgctggacgttggcgcaaccgccatcaac
gaagagatgaaactggcggcggtacgcgcgattgcagaactggcccatgcggaacagagt
gaagtggtggcttcagcgtatggcgatcaggatctgagctttggccctgaatacatcatt
ccaaaaccgtttgatccgcgtctgatagtcaagattgctcctgcggtcgcgaaagcggcg
atggagtcgggcgtggcgacgcgtccgattgctgatttcgacgtctacatcgacaagctg
actgagttcgtttacaaaaccaacctgtttatgaagccgattttctcccaggctcgcaaa
gcgccgaagcgcgtagttctgccggaaggggaagaggcgcgcgttctgcatgccactcag
gaactggtaacgctgggactggcgaaaccgatccttatcggtcgtccgaacgtgatcgaa
atgcgcattcagaaactgggcttgcagatcaaagcgggcgttgattttgagatcgtcaat
aacgaatccgatccgcgctttaaagagtactggaccgaatacttccagatcatgaagcgt
cgcggcgtcactcaggaacaggcgcagcgggcgctgatcagtaacccgacagtgatcggc
gcgatcatggttcagcgtggcgaagccgatgcaatgatttgcggtacggtgggtgattat
catgaacattttagcgtggtgaaaaatgtctttggttatcgcgatggcgttcacaccgca
ggtgcaatgaacgcgctgctgctgccgagtggtaacacctttattgccgatacctacgtc
aatgacgaaccagacgcagaagagctggcggagatcaccttgatggcggcagaaactgtc
cgtcgtttcggtattgaaccgcgcgttgctctgttgtcgcactccaactttggttcttct
gactgcccgtcgtcgagcaaaatgcgtcaggcgctggaactggtcagggaacgtgcgcca
gaactgatgattgatggtgaaatgcacggcgatgcagcgctggtggaagcgattcgcaac
gaccgtatgccggacagccctttgaaaggttctgccaatattctggtgatgccgaacatg
gaagctgcccgcattagttacaacttactgcgcgtttccagctcggaaggtgtgactgtc
ggtccggtgctgatgggcgtggcgaaaccggttcacgtgttaacgccgatcgcatcggtg
cgtcgtatcgtcaacatggtggcgctggccgtggttgaagcgcaaacccaaccgctgtaa

DBGET integrated database retrieval system