KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3284Help
Entry
CDCO157_3284      CDS       T02122                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00250  Alanine, aspartate and glutamate metabolism
elx00280  Valine, leucine and isoleucine degradation
elx00310  Lysine degradation
elx00410  beta-Alanine metabolism
elx00640  Propanoate metabolism
elx00650  Butanoate metabolism
elx01100  Metabolic pathways
elx01120  Microbial metabolism in diverse environments
Module
elx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CDCO157_3284
   00650 Butanoate metabolism
    CDCO157_3284
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDCO157_3284
   00280 Valine, leucine and isoleucine degradation
    CDCO157_3284
   00310 Lysine degradation
    CDCO157_3284
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDCO157_3284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:elx01007]
    CDCO157_3284
Enzymes [BR:elx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CDCO157_3284
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CDCO157_3284
    2.6.1.48  5-aminovalerate transaminase
     CDCO157_3284
Amino acid related enzymes [BR:elx01007]
 Aminotransferase (transaminase)
  Class III
   CDCO157_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFJ30341
UniProt: A0A0F6C7Y5
LinkDB All DBs
Structure
PDB: 

Position
3442587..3443867
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcaattcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgctgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggc
ctgatgccagggcacgtttatcgcgcgctttatccttgcccactgcacggcatcagtgaa
gatgatgctatcgccagtatccaccgaatttttaaaaatgatgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgcctgcg
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggcttcccactggcgggcgtcacc
gggcgcgccgaagtgatggatgccgtcgctccaggcgggctgggtggcacctatgccggt
aatccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcagaaagccaacgatctggggcagaagttgaaagatggattgttggcgatcgccgaa
aaacaccctgagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcaaagcagtag

DBGET integrated database retrieval system