KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_4284Help
Entry
CDCO157_4284      CDS       T02122                                 

Definition
(GenBank) EspF
  KO
K12786  LEE-encoded effector EspF
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx05130  Pathogenic Escherichia coli infection
Module
elx_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:elx00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    CDCO157_4284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-ProteinID: AFJ31340
UniProt: A0A0F6CAT4
LinkDB All DBs
Position
complement(4516515..4516979)
Genome map
AA seq 154 aa AA seqDB search
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKP
ARQAPPPPTGPSGLPPLAQALKDHLAAYEQSKKG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattagtaacgctgcttctacactagggcggcagcttgtaggtatcgca
agtcgagtgagctctgcggggggaactggattttctgtagcccctcaggccgtgcgtctt
actccggtgaaagttcattcccctttttctccaggctcgtcgaatgttaatgcgagaacg
atttttaatgtgagcagccaggtgacttcatttactccctctcgtccggcaccgccgcca
ccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggcatta
aaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagccc
gcccgtcaggcaccaccgccaccgacagggcctagtggactaccgccccttgcacaggca
ttaaaagatcatttagctgcctatgagcaatcgaagaaagggtaa

DBGET integrated database retrieval system