KEGG   Escherichia marmotae: C1192_00450Help
Entry
C1192_00450       CDS       T05353                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ema  Escherichia marmotae
Pathway
ema00220  Arginine biosynthesis
ema00250  Alanine, aspartate and glutamate metabolism
ema00290  Valine, leucine and isoleucine biosynthesis
ema01100  Metabolic pathways
ema01110  Biosynthesis of secondary metabolites
ema01130  Biosynthesis of antibiotics
ema01210  2-Oxocarboxylic acid metabolism
ema01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C1192_00450
   00290 Valine, leucine and isoleucine biosynthesis
    C1192_00450
   00220 Arginine biosynthesis
    C1192_00450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ema01007]
    C1192_00450
Enzymes [BR:ema01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     C1192_00450
    2.6.1.66  valine---pyruvate transaminase
     C1192_00450
Amino acid related enzymes [BR:ema01007]
 Aminotransferase (transaminase)
  Class I
   C1192_00450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AUT25762
UniProt: A0A370VBU4
LinkDB All DBs
Position
complement(77257..78474)
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
MPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaataaggtattgaaactgaacatc
ggcaacccagccccgttcggttttgacgctcccgatgagattctggttgacgtgatacgc
aacctcccgacagctcagggttattgcgattcaaaaggcctctattctgcgcgtaaggct
atcatgcagcattaccaggcacgtggcatgcgtgatgttaccgtggaagatatttacatc
ggaaatggtgtatcggagcttatcgttcaggcaatgcaagcattgctgaacagtggggat
gagatgttggttcctgcacctgattacccgctatggacagcggcagtttcgctctcaggc
ggtaaagcggtgcactatctttgcgatgaatcctctgactggttcccggatctcgatgac
attcgcgccaaaattacgccacgcacgcgcggcattgttattatcaacccgaacaaccca
acaggcgcggtttattccaaagagctattaatggagattgtggagattgcgcgtcagcat
aacctcattatcttcgctgatgaaatttacgataaaatcctctacgacgacgccgagcat
cactcgatcgcgccgttggctcctgacctgctgaccattacctttaacgggctgtcgaaa
acgtatcgtgttgcgggattccgccagggctggatggtgctgaacgggccgaaaaaacac
gccaaaggttatatcgaaggtctggaaatgctggcctcaatgcggctgtgcgccaacgtt
cccgcgcaacacgcgatacagacagcgctgggcggctatcagagcatcagcgagtttatc
atgccgggcgggcgtctttacgagcagcgtaaccgtgcgtgggagttgattaatgatatt
cctggcgtttcctgcgtaaaacctcgcggcgcgctatacatgttcccgaaaatagacgcc
aaacgctttaatattcacgacgaccagaaaatggtgctggatttcctgttgcaggaaaaa
gttctgctggtacagggaaccgcatttaactggccgtggccggatcacttccgcattgtc
acgctgccgcgtgttgatgatatcgaactgtccttgagcaagttcgctcgtttcctttct
ggttatcatcagttgtaa

DBGET integrated database retrieval system