KEGG   Escherichia marmotae: C1192_04750Help
Entry
C1192_04750       CDS       T05353                                 

Definition
(GenBank) formate dehydrogenase cytochrome b556 subunit
  KO
K08350  formate dehydrogenase-N, gamma subunit
Organism
ema  Escherichia marmotae
Pathway
ema02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ema00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C1192_04750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405
Motif
Other DBs
NCBI-ProteinID: AUT26514
UniProt: A0A370V5H2
LinkDB All DBs
Position
877840..878493
Genome map
AA seq 217 aa AA seqDB search
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFFRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPIQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMVEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcgaaaatgattgtgcgcaccaagtttattgatcgcgcctgtcactggacc
gtggtgatttgcttcttcctggtggcactttccgggatttcgttcttcttcccgacgctg
caatggctgacgcaaaccttcggtacgccgcagatgggacgcattttgcacccattcttc
ggcattgcgatttttgttgcgctgatgtttatgttcttccgctttgtgcatcacaacatc
ccggataagaaagatattccgtggctgttgaacattgtcgaagtattgaaaggcaatgag
cacaaagtggcggatgtcggtaagtacaacgccgggcagaagatgatgttctggtcgatc
atgagcatgattttcgtgctgctggtgaccggggtgattatctggcgtccgtactttgcg
cagtacttcccgattcaggttgtccgctacagtctgctgatccacgcagccgcgggtatc
atcctgatccacgccatcctgatccatatgtatatggcattctgggtgaaagggtcgatt
aaagggatggtcgaaggaaaggtgagccgtcgttgggcgaagaaacaccatccgcgctgg
tatcgtgaaatcgagaaggccgaagcgaaaaaagagagtgaagaagggatataa

DBGET integrated database retrieval system