KEGG   Escherichia marmotae: C1192_04820Help
Entry
C1192_04820       CDS       T05353                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ema  Escherichia marmotae
Pathway
ema00250  Alanine, aspartate and glutamate metabolism
ema00410  beta-Alanine metabolism
ema00430  Taurine and hypotaurine metabolism
ema00650  Butanoate metabolism
ema01100  Metabolic pathways
ema01110  Biosynthesis of secondary metabolites
ema01120  Microbial metabolism in diverse environments
ema02024  Quorum sensing
Module
ema_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C1192_04820
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C1192_04820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1192_04820
   00430 Taurine and hypotaurine metabolism
    C1192_04820
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C1192_04820
Enzymes [BR:ema01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C1192_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUT26526
LinkDB All DBs
Position
complement(891247..892647)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDIAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPKELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVATYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLCGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtctgaactactcgattcacgttttggcgcg
aaatctatttccactatcgcggaatcgaaacgttttccgctgcatgaaatgcgcgatgat
atcgccttccagattatcaatgatgaattatacctggatggcaatgcccgacaaaacctc
gccacattttgtcagacctgggacgatgaaaatgttcataagttgatggatctgtcgatc
aataaaaactggatcgataaagaagaatatccgcagtccgcagcaattgatctgcgttgc
gtaaacatggttgctgatctgtggcacgcgcctgcgccgaaaaacggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagccgcaggtaaaccgaccgataaaccaaacctggtgtgcggt
ccggtgcaaatctgttggcataaattcgcccgctactgggatgtggaattgcgcgagatc
cctatgcgccccggtcagttgtttatggatccgaaacggatgattgaggcctgcgacgaa
aacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagtttccg
caaccgctgcacgatgcgctggataagttccaggccgacaccggtatcgacatcgatatg
catatcgacgctgccagcggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccacgcgtgaaatcgatcagtgcttctggtcataaatttggtctggct
ccgctgggctgcggctgggttatctggcgtgacgaagaagcactgccgaaagagctggtg
tttaacgttgactatctcggtgggcaaatcgggacttttgccatcaacttctcgcgtccg
gcgggtcaggtgattgcccagtactatgaattcctgcgcctcggtcgtgaaggctacacc
aaagtgcagaacgcctcttatcaggtcgccacttacctggcggatgaaatcgctaaactg
ggaccgtatgagttcatctgcaccggtcgcccggacgaaggtatcccggcggtttgcttc
aaactgaaagacggggaagatccgggatacaccctgtatgacctctctgaacgtctgcgc
ctgtgcggctggcaggttccagccttcacccttggcggtgaagccactgacatcgtggtg
atgcgtattatgtgtcgtcgtggcttcgaaatggacttcgctgaactgttgctggaagac
tacaaagcctccctgaaatacctcagcgatcacccgaaactgcagggtattgcccagcag
aacagctttaaacatacctga

DBGET integrated database retrieval system