KEGG   Escherichia marmotae: C1192_10745Help
Entry
C1192_10745       CDS       T05353                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ema  Escherichia marmotae
Pathway
ema00730  Thiamine metabolism
ema00790  Folate biosynthesis
ema01100  Metabolic pathways
ema02020  Two-component system
Module
ema_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    C1192_10745
   00790 Folate biosynthesis
    C1192_10745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C1192_10745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ema04147]
    C1192_10745
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ema00537]
    C1192_10745
Enzymes [BR:ema01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     C1192_10745
Exosome [BR:ema04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C1192_10745
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ema00537]
 Enzymes
  C1192_10745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AUT27537
LinkDB All DBs
Position
complement(2061858..2063270)
Genome map
AA seq 470 aa AA seqDB search
MKQSTIALALLPLLFTPVTNAQTPQTPILENRAAQGDITTPGGARRLTGDQTAALRDSLS
DKPVKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKRTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSVTSEKCPSNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVTDTASLEAVTEANQDKPLLGLFSDGNMPVRWKGPKASYHGN
IDKPAVTCTPNPQRNDSIPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVVVTADHAHASQIVPPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggctctcttaccgttattgtttacccctgtaacaaac
gcccagacgccgcagacacccattctggaaaaccgggctgcacagggagatattactacg
cccggcggtgcccgccgtttaacaggcgatcagaccgccgccttgcgtgattcacttagc
gataagccggtaaaaaatattatattactgattggcgatgggatgggggattcggaaatt
actgccgcacgaaattatgccgaaggtgcgggcggtttttttaaaggaatcgatgcgtta
ccgcttaccgggcaatacactcactattctctggataaaagaaccggtaaaccggactac
gtaaccgactccgctgcgtcagcaaccgcctggtcaactggcgtcaaaacctataacggc
gcgttgggcgtcgatattcatgaaaaagatcatccaacgatactggagatggcaaaagcc
gcaggcctggccactggcaacgtttcaacggctgaattgcaggatgccacacctgccgcg
ctggtggcgcatgtgacgtcgcgcaaatgctacggaccgagcgttaccagtgaaaaatgc
ccgagtaatgcgctggaaaaaggcggtaaaggctccatcactgaacaactgcttaacgct
cgtgccgatgtaacgcttggcggcggtgcaaaaacgtttgcagaaacagcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaagcacaggcgcgtggttatcagttagtgact
gatacagcctcgttagaagcggtgacggaggcaaatcaggataaaccactgctcggatta
ttttccgatggcaatatgccggtacgctggaaaggtccaaaggcgtcttatcacggcaat
atcgataagcctgcggtaacttgtactccgaatccgcagcgtaatgacagcataccgacg
ttagcgcagatgaccgacaaggccattgagttattaagtaaaaatgaaaaaggcttcttc
ctgcaagtcgaaggtgcatcgatcgacaaacaggatcacgccgcgaatccttgtgggcaa
attggtgagacggttgaccttgatgaagctgtacaacgggcgctggaatttgccaaaaaa
gatggtaacaccctggtagtggtaacggctgaccatgctcacgccagccaaattgtcccg
ccggataccaaagcaccgggtctgactcaggcgttaaataccaaagatggcgcagtaatg
gtgatgagctacggtaactctgaagaggattcgcaagagcatactggcagccagttgcgt
attgctgcttatggcccgcacgctgcaaatgtcgttggcctgaccgatcagaccgatctc
ttctacaccatgaaagccgcattgggcctgtaa

DBGET integrated database retrieval system